BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1025 (470 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC021855-1|AAH21855.1| 371|Homo sapiens zinc finger and BTB dom... 30 3.5 AK127065-1|BAC86810.1| 645|Homo sapiens protein ( Homo sapiens ... 30 3.5 AB033016-1|BAA86504.1| 174|Homo sapiens KIAA1190 protein protein. 30 3.5 BC139779-1|AAI39780.1| 606|Homo sapiens zinc finger protein 652... 30 4.6 AB023141-1|BAA76768.2| 617|Homo sapiens KIAA0924 protein protein. 30 4.6 >BC021855-1|AAH21855.1| 371|Homo sapiens zinc finger and BTB domain containing 47 protein. Length = 371 Score = 30.3 bits (65), Expect = 3.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 251 FRFEGCGSRCNYT*DLRTYISRWVAHLRCRCLW 349 FR E C R Y LR+++S + H + C W Sbjct: 200 FRCENCNERFQYKYQLRSHMSIHIGHKQFMCQW 232 >AK127065-1|BAC86810.1| 645|Homo sapiens protein ( Homo sapiens cDNA FLJ45122 fis, clone BRAWH3036247, weakly similar to Zinc finger protein 228. ). Length = 645 Score = 30.3 bits (65), Expect = 3.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 251 FRFEGCGSRCNYT*DLRTYISRWVAHLRCRCLW 349 FR E C R Y LR+++S + H + C W Sbjct: 474 FRCENCNERFQYKYQLRSHMSIHIGHKQFMCQW 506 >AB033016-1|BAA86504.1| 174|Homo sapiens KIAA1190 protein protein. Length = 174 Score = 30.3 bits (65), Expect = 3.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 251 FRFEGCGSRCNYT*DLRTYISRWVAHLRCRCLW 349 FR E C R Y LR+++S + H + C W Sbjct: 3 FRCENCNERFQYKYQLRSHMSIHIGHKQFMCQW 35 >BC139779-1|AAI39780.1| 606|Homo sapiens zinc finger protein 652 protein. Length = 606 Score = 29.9 bits (64), Expect = 4.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 251 FRFEGCGSRCNYT*DLRTYISRWVAHLRCRCLW 349 FR E C R Y LR+++S + H + C W Sbjct: 385 FRCENCDERFQYKYQLRSHMSIHIGHKQFMCQW 417 >AB023141-1|BAA76768.2| 617|Homo sapiens KIAA0924 protein protein. Length = 617 Score = 29.9 bits (64), Expect = 4.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 251 FRFEGCGSRCNYT*DLRTYISRWVAHLRCRCLW 349 FR E C R Y LR+++S + H + C W Sbjct: 396 FRCENCDERFQYKYQLRSHMSIHIGHKQFMCQW 428 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,832,365 Number of Sequences: 237096 Number of extensions: 1570824 Number of successful extensions: 2065 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2065 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4099895856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -