BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1025 (470 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 3.8 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 21 6.7 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 21 6.7 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 6.7 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 6.7 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -1 Query: 371 GVKWLLEPIDIYNVNAPPTSRYKF*DLRYSYNGY 270 GVK L+ ++ ++ PP S +F +++ + Y Sbjct: 144 GVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSY 177 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 371 GVKWLLEPIDIYNVNAPPTSRYKF*DLRYSYNGY 270 GVK L+ ++ + PP S +F +++ + Y Sbjct: 71 GVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSY 104 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.0 bits (42), Expect = 6.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 80 RISLEKLVPACGIRTSV 30 +I L +VP C I TS+ Sbjct: 23 QIGLRAVVPICRIETSI 39 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 371 GVKWLLEPIDIYNVNAPPTSRYKF*DLRYSYNGY 270 GVK L+ ++ + PP S +F +++ + Y Sbjct: 87 GVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSY 120 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 371 GVKWLLEPIDIYNVNAPPTSRYKF*DLRYSYNGY 270 GVK L+ ++ + PP S +F +++ + Y Sbjct: 144 GVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSY 177 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,741 Number of Sequences: 438 Number of extensions: 3153 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -