BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1020 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 25 1.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 7.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 7.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.9 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 24.6 bits (51), Expect = 1.1 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 328 STSPKARHCGSSWS-INGAFRHHKHRSPSSSNPSLATKGSTSEL 456 STSP AR S + ++ A HH H+ + + A G+TS + Sbjct: 77 STSPAARTTSSMYPYVSAAAAHHHHQQQQA--VAAAAFGATSSM 118 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -3 Query: 594 SSRGSNRRVANTGPSKSSAWQNLPTGSETRPTEKIRRETQ 475 S+ G+ + + S+A + TG+ T PT ++R+ Q Sbjct: 232 SATGTGPATPSAVVATSNATAAMTTGTTTIPTRRLRKRRQ 271 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 563 TLALARAVLGRIYPPD 516 TLAL+ ++L RI+ PD Sbjct: 74 TLALSISMLARIWKPD 89 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +2 Query: 329 RRRPKHVIADRPGPLTVLLGTTST 400 R P H RP T + TTST Sbjct: 212 RHLPGHAQMGRPSYTTATMATTST 235 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 696 KRRPVNCNTTHYRANWVPGP 637 K++P +C+T YR V P Sbjct: 565 KKQPSDCDTLEYRNGEVTTP 584 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,192 Number of Sequences: 438 Number of extensions: 4421 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -