BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1018 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 1.4 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 3.3 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 3.3 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = -3 Query: 635 DTKTSQMQIVLVKEILLQVHTYYNAKILFLQPII 534 D +T Q + + + L ++T+Y+ K +FL+ +I Sbjct: 9 DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELI 42 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -1 Query: 478 LKRMKFILQMLQLIG 434 LK++KF+L++ QL+G Sbjct: 78 LKKLKFLLKLGQLLG 92 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -1 Query: 478 LKRMKFILQMLQLIG 434 LK++KF+L++ QL+G Sbjct: 4 LKKLKFLLKLGQLLG 18 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,539 Number of Sequences: 336 Number of extensions: 3044 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -