BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1012 (801 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 3.7 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.0 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 21 8.7 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 133 AERSRAWPSVPERGRARPSAAERCSHYTSGLPEQCTA 243 A R+ P+ + +A P+AA R +G+P T+ Sbjct: 194 ASRTTTSPTKVKASKASPAAAPRSVATPTGIPTPSTS 230 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 107 PSAERSRAWPSVPERGRAFPSVAERGRARPSVVLTTQ 217 PSA+ S+ + P+ G+ P + R + V TT+ Sbjct: 419 PSADGSKPVQTTPKPGQWVPEKSTSTTQRTTTVSTTE 455 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 166 ERGRARPSAAERCSHYTSGLPEQCT 240 E+G+ P AE H L +C+ Sbjct: 52 EKGKCTPDGAELKRHLPDALHTECS 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,682 Number of Sequences: 336 Number of extensions: 4158 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -