BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1011 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 26 0.35 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 7.4 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 7.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.8 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.8 bits (54), Expect = 0.35 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 263 WLLVNNVS-KRGSTYSLLHFVF*YLKWSVVFLNG*TLEHCNYSETLELISQGGR 421 W+ + +++ +R +TYS + + F L W +V L G + SE L+ + G R Sbjct: 660 WMALESLTHQRYTTYSDV-WSFGVLLWEIVTLGGTPYVGVHSSELLDFLKSGNR 712 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +3 Query: 219 IPQVTDNVDLKCGLY 263 IPQ++DN+ + C L+ Sbjct: 223 IPQISDNLYILCRLH 237 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +3 Query: 219 IPQVTDNVDLKCGLY 263 IPQ++DN+ + C L+ Sbjct: 223 IPQISDNLYILCRLH 237 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 260 LWLLVNNVSKRGSTYSLLH 316 L L +N +S +G Y+LLH Sbjct: 431 LTLEINGLSFQGLEYTLLH 449 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,288 Number of Sequences: 336 Number of extensions: 3906 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -