BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1009 (582 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.8 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 24 4.1 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 1.8 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 298 HGHDNVFLMSFIQVHTEVLDLPSSCGSNLSLRVLEQ 191 HG+ N+ + +HT+ L+ G+NL+L L Q Sbjct: 3288 HGNGNILMERLKALHTDALEEIELHGANLALDNLFQ 3323 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.8 bits (49), Expect = 4.1 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 149 DQQLVAALRTYQRPCTAPSTKYLRHEPARSASHVAPYPRVPAEKP 15 D + A R + P P TK R + +PY VP+ +P Sbjct: 198 DSDSMGASRHGKTPLATPPTKEKRKPFFKKQETSSPYDVVPSMRP 242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,593 Number of Sequences: 2352 Number of extensions: 14902 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -