BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1006 (502 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 33 2.7 UniRef50_Q0IDF5 Cluster: Glycosyl transferase WecB/TagA/CpsF fam... 33 3.6 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 33.5 bits (73), Expect = 2.7 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 461 RGGARYPIRPIVSR 502 RGGARYPIRPIVSR Sbjct: 260 RGGARYPIRPIVSR 273 >UniRef50_Q0IDF5 Cluster: Glycosyl transferase WecB/TagA/CpsF family protein; n=13; Cyanobacteria|Rep: Glycosyl transferase WecB/TagA/CpsF family protein - Synechococcus sp. (strain CC9311) Length = 303 Score = 33.1 bits (72), Expect = 3.6 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -1 Query: 253 HGFIFEHSWPRFDIRI--LNPKPYLFIA*VNEGVLGLTKLRSVSSGIHLTLGGS 98 HG++ E WP+ + + LNP L V L + +L++ +G+ + +GGS Sbjct: 183 HGYLTEEDWPQLEANLCELNPDLVLVALGVPRQELWVQRLKASQTGVWMGVGGS 236 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,437,152 Number of Sequences: 1657284 Number of extensions: 9406119 Number of successful extensions: 15943 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15939 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29691847201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -