BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1006 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.01c |trl1|SPAC6C3.10c|tRNA ligase Trl1 |Schizosaccharom... 25 4.8 SPBC12D12.01 |sad1|SPBC16H5.01c|spindle pole body protein Sad1|S... 25 4.8 SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 25 6.4 SPAC821.07c |moc3||transcription factor Moc3|Schizosaccharomyces... 25 8.4 >SPAC17G8.01c |trl1|SPAC6C3.10c|tRNA ligase Trl1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 787 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 422 LPHPSNRNGLLLHGRNR 372 LP+ N GL LHG NR Sbjct: 198 LPYTGNSRGLYLHGLNR 214 >SPBC12D12.01 |sad1|SPBC16H5.01c|spindle pole body protein Sad1|Schizosaccharomyces pombe|chr 2|||Manual Length = 514 Score = 25.4 bits (53), Expect = 4.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 128 FRYPLNIRWIEQSIIYRRKNNPLI 57 FRYP+N R +S Y K PL+ Sbjct: 149 FRYPMNQRSTRKSQFYSSKFKPLL 172 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.0 bits (52), Expect = 6.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 359 YHHPAYFCREAVIRFGSKGGAAVVTILETLELISRGG 469 + P+ F E V+ GG AVV + TLE I + G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 >SPAC821.07c |moc3||transcription factor Moc3|Schizosaccharomyces pombe|chr 1|||Manual Length = 497 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 194 LWI*NPNIKPWPRMFKNKT 250 L+I NPN++P P+ K +T Sbjct: 14 LYIPNPNVEPTPKPTKRRT 32 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,994,039 Number of Sequences: 5004 Number of extensions: 38873 Number of successful extensions: 58 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -