BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1006 (502 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1749 - 39636951-39638102 30 1.2 02_05_0271 + 27342468-27343577 29 1.6 02_02_0262 - 8396755-8397244,8398659-8398705 27 8.5 >01_06_1749 - 39636951-39638102 Length = 383 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 441 SSIVTTAAPPFEPKRITA 388 SS+ + AAPPF+P RIT+ Sbjct: 164 SSVASAAAPPFDPSRITS 181 >02_05_0271 + 27342468-27343577 Length = 369 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 359 YHHPAYFCREAVIRFGSKGGAAVVTILETLELISRGGARYPIRP 490 +HH + ++RFG GG A+ LE L S A P+ P Sbjct: 21 HHHHHHGASPDLLRFGGSGGGAMAARLEHLLSSSSASAFRPLPP 64 >02_02_0262 - 8396755-8397244,8398659-8398705 Length = 178 Score = 27.1 bits (57), Expect = 8.5 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 471 APPRDISSKVSSIVTTAAPP 412 +PPR++++K ++ TAAPP Sbjct: 151 SPPREVAAKEATAAETAAPP 170 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,658,016 Number of Sequences: 37544 Number of extensions: 271582 Number of successful extensions: 533 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -