BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1006 (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 3.3 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 23 4.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.7 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.8 bits (49), Expect = 3.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 480 GYRAPPRDISSKVSSIVTTAAPPFEP 403 G RAPP +++ SIVT P P Sbjct: 430 GGRAPPETERARLESIVTELFPQHPP 455 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 23.4 bits (48), Expect = 4.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 404 GSKGGAAVVTILETLELISRGGARYP 481 G +GG ++ T L L + GARYP Sbjct: 35 GIEGGHSIGTSLGVLRTFYQLGARYP 60 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 7.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 368 PAYFCREAVIRFGSKGGAAVVTILETLELISRGGARYP 481 PA+FC V + + + +I LE I G A +P Sbjct: 2711 PAFFCSNVVRLVALQVVSPIDSISHGLEQICGGSADFP 2748 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,851 Number of Sequences: 2352 Number of extensions: 9876 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -