BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1006 (502 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99171-4|CAB16313.1| 722|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z81495-8|CAB04063.1| 239|Caenorhabditis elegans Hypothetical pr... 27 7.6 >Z99171-4|CAB16313.1| 722|Caenorhabditis elegans Hypothetical protein F47G4.4 protein. Length = 722 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 81 IDNRLLDPPNVKWIPELTDLSLVRPRTPSFT 173 +DN +D VK +PELT+LS + PR+P + Sbjct: 312 VDNSPID--EVKALPELTELSNLPPRSPGLS 340 >Z81495-8|CAB04063.1| 239|Caenorhabditis elegans Hypothetical protein F08G2.8 protein. Length = 239 Score = 27.1 bits (57), Expect = 7.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 247 FIFEHSWPRFDIRILNPKPYLF 182 ++ + WP+FD R +NP+P F Sbjct: 200 YLPQDKWPQFDQRWMNPQPTQF 221 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,087,637 Number of Sequences: 27780 Number of extensions: 218599 Number of successful extensions: 344 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -