BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0997 (451 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08730.1 68416.m01015 serine/threonine protein kinase (PK1) (... 70 6e-13 At3g08720.2 68416.m01014 serine/threonine protein kinase (PK19) ... 69 1e-12 At3g08720.1 68416.m01013 serine/threonine protein kinase (PK19) ... 69 1e-12 At3g17850.1 68416.m02275 protein kinase, putative similar to IRE... 48 3e-06 At1g48490.1 68414.m05420 protein kinase, putative similar to inc... 46 2e-05 At2g20470.1 68415.m02390 protein kinase, putative contains prote... 45 3e-05 At1g45160.1 68414.m05177 protein kinase family protein contains ... 43 1e-04 At1g30640.1 68414.m03747 protein kinase, putative contains prote... 43 1e-04 At2g36350.1 68415.m04461 protein kinase, putative similar to pro... 42 1e-04 At5g40030.1 68418.m04854 protein kinase, putative similar to stp... 42 2e-04 At2g44830.1 68415.m05582 protein kinase, putative similar to pro... 42 3e-04 At2g26700.1 68415.m03203 protein kinase family protein contains ... 42 3e-04 At3g45780.1 68416.m04953 protein kinase / nonphototropic hypocot... 41 3e-04 At1g53700.1 68414.m06110 protein kinase, putative similar to cuc... 41 4e-04 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /... 40 6e-04 At5g03640.1 68418.m00323 protein kinase family protein contains ... 40 6e-04 At3g14370.1 68416.m01818 protein kinase family protein contains ... 40 0.001 At1g03920.1 68414.m00377 protein kinase, putative contains prote... 40 0.001 At3g52890.2 68416.m05829 protein kinase (KIPK) identical to prot... 39 0.001 At3g52890.1 68416.m05828 protein kinase (KIPK) identical to prot... 39 0.001 At5g58140.3 68418.m07277 protein kinase family protein / non pho... 39 0.002 At5g58140.2 68418.m07276 protein kinase family protein / non pho... 39 0.002 At5g58140.1 68418.m07275 protein kinase family protein / non pho... 39 0.002 At3g44610.1 68416.m04796 protein kinase family protein similar t... 39 0.002 At2g20040.1 68415.m02342 protein kinase, putative similar to pro... 38 0.002 At3g23310.1 68416.m02940 protein kinase, putative contains prote... 38 0.003 At3g12690.3 68416.m01586 protein kinase, putative similar to vir... 38 0.003 At3g12690.2 68416.m01585 protein kinase, putative similar to vir... 38 0.003 At3g12690.1 68416.m01584 protein kinase, putative similar to vir... 38 0.003 At2g19400.1 68415.m02263 protein kinase, putative contains prote... 38 0.003 At1g16440.1 68414.m01966 protein kinase, putative similar to vir... 38 0.004 At1g51170.1 68414.m05754 protein kinase family protein 37 0.007 At5g47750.1 68418.m05899 protein kinase, putative similar to pro... 36 0.010 At3g27580.1 68416.m03446 protein kinase, putative similar to ser... 36 0.010 At3g20830.1 68416.m02634 protein kinase family protein contains ... 36 0.010 At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein ki... 36 0.010 At1g79250.1 68414.m09239 protein kinase, putative similar to vir... 36 0.010 At4g13000.1 68417.m02029 protein kinase family protein contains ... 35 0.029 At5g55910.1 68418.m06972 protein kinase, putative contains prote... 33 0.067 At4g26610.1 68417.m03835 protein kinase, putative similar to pro... 33 0.067 At3g25250.1 68416.m03154 protein kinase family protein contains ... 33 0.067 At2g34650.1 68415.m04256 protein kinase PINOID (PID) identical t... 33 0.067 At5g04510.2 68418.m00450 3-phosphoinositide-dependent protein ki... 32 0.16 At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein ki... 32 0.16 At5g09890.1 68418.m01143 protein kinase, putative contains prote... 31 0.36 At3g10160.1 68416.m01218 dihydrofolate synthetase/folylpolygluta... 29 1.5 At2g18915.2 68415.m02208 F-box family protein / LOV kelch protei... 29 1.5 At2g18915.1 68415.m02207 F-box family protein / LOV kelch protei... 29 1.5 At2g40830.3 68415.m05041 zinc finger (C3HC4-type RING finger) fa... 29 1.9 At2g40830.2 68415.m05040 zinc finger (C3HC4-type RING finger) fa... 29 1.9 At2g40830.1 68415.m05039 zinc finger (C3HC4-type RING finger) fa... 29 1.9 At3g61570.1 68416.m06896 intracellular protein transport protein... 28 2.5 At2g12190.1 68415.m01316 cytochrome P450, putative 28 2.5 At1g64950.1 68414.m07362 cytochrome P450, putative similar to cy... 28 2.5 At4g29860.1 68417.m04250 transducin family protein / WD-40 repea... 28 3.4 At3g09000.1 68416.m01053 proline-rich family protein 27 4.4 At1g64940.1 68414.m07361 cytochrome P450, putative similar to cy... 27 5.9 At1g33770.1 68414.m04174 protein kinase family protein contains ... 27 5.9 At5g43935.1 68418.m05375 flavonol synthase, putative similar to ... 27 7.7 At4g04695.1 68417.m00689 calcium-dependent protein kinase, putat... 27 7.7 >At3g08730.1 68416.m01015 serine/threonine protein kinase (PK1) (PK6) identical to serine/threonine-protein kinase AtPK1/AtPK6 (ribosomal-protein S6 kinase ATPK6) [Arabidopsis thaliana] SWISS-PROT:P42818 Length = 465 Score = 70.1 bits (164), Expect = 6e-13 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 2/87 (2%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRM 181 K+P RRLG G AEE+K+H +F+ +NW + REV F P++S NF +T M Sbjct: 367 KEPERRLGSGLSGAEEIKQHKWFKGINWKKLEAREVMPSFKPEVSGRQCIANFDKCWTDM 426 Query: 182 PPTDSPAQAPKHSDKL--FMGYSYVAP 256 DSPA +P K F ++YV P Sbjct: 427 SVLDSPASSPSSDPKANPFTNFTYVRP 453 >At3g08720.2 68416.m01014 serine/threonine protein kinase (PK19) identical to serine/threonine-protein kinase AtPK19 (Ribosomal-protein S6 kinase homolog) [Arabidopsis thaliana] SWISS-PROT:Q39030 Length = 471 Score = 69.3 bits (162), Expect = 1e-12 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRM 181 K+P RRLG G AEE+K+H +F+ +NW + REV F P +S NF +T M Sbjct: 373 KEPERRLGSGPSGAEEIKKHKWFKAINWKKLEAREVQPSFKPAVSGRQCIANFDKCWTDM 432 Query: 182 PPTDSPAQAPKHSDKL--FMGYSYVAP 256 DSPA +P K F ++YV P Sbjct: 433 SVLDSPASSPNSDAKANPFTNFTYVRP 459 >At3g08720.1 68416.m01013 serine/threonine protein kinase (PK19) identical to serine/threonine-protein kinase AtPK19 (Ribosomal-protein S6 kinase homolog) [Arabidopsis thaliana] SWISS-PROT:Q39030 Length = 471 Score = 69.3 bits (162), Expect = 1e-12 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRM 181 K+P RRLG G AEE+K+H +F+ +NW + REV F P +S NF +T M Sbjct: 373 KEPERRLGSGPSGAEEIKKHKWFKAINWKKLEAREVQPSFKPAVSGRQCIANFDKCWTDM 432 Query: 182 PPTDSPAQAPKHSDKL--FMGYSYVAP 256 DSPA +P K F ++YV P Sbjct: 433 SVLDSPASSPNSDAKANPFTNFTYVRP 459 >At3g17850.1 68416.m02275 protein kinase, putative similar to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783; contains protein kinase domain Pfam:PF00069 Length = 1296 Score = 48.0 bits (109), Expect = 3e-06 Identities = 24/58 (41%), Positives = 36/58 (62%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFT 175 +DP +RLG A E+K+H FF+++NWD +AR++ A FVP A DT F ++ Sbjct: 1151 EDPHQRLGAR--GAAEVKQHIFFKDINWDTLARQK--AAFVPASESAIDTSYFRSRYS 1204 >At1g48490.1 68414.m05420 protein kinase, putative similar to incomplete root hair elongation (IRE) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 Length = 878 Score = 45.6 bits (103), Expect = 2e-05 Identities = 22/58 (37%), Positives = 38/58 (65%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFT 175 +DP +RLG A E+K+HSFF++++W+ +A+++ A FVP +A DT F ++ Sbjct: 734 EDPHQRLGAR--GAAEVKQHSFFKDIDWNTLAQQK--AAFVPDSENAFDTSYFQSRYS 787 >At2g20470.1 68415.m02390 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 596 Score = 44.8 bits (101), Expect = 3e-05 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 6/85 (7%) Frame = +2 Query: 11 RRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFA--DEFTRMP 184 RRRLG +G A+ELK H++F+ ++WD + ++ A FVP+++ DT NF DE Sbjct: 404 RRRLGS-KG-ADELKAHTWFETVDWDTIF--DMDAAFVPEVNDDLDTQNFEKFDESESET 459 Query: 185 PTDSPA----QAPKHSDKLFMGYSY 247 T S + + D F+GY+Y Sbjct: 460 QTSSKSGPWRKMLSSKDINFVGYTY 484 >At1g45160.1 68414.m05177 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 1067 Score = 42.7 bits (96), Expect = 1e-04 Identities = 23/64 (35%), Positives = 35/64 (54%) Frame = +2 Query: 5 DPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRMP 184 +P +RLG A E+K H FFQ ++W+ +A ++ A FVPQ DT F F+ Sbjct: 936 EPEKRLGAN--GAAEVKSHPFFQGVDWENLALQK--AAFVPQPESINDTSYFVSRFSESS 991 Query: 185 PTDS 196 +D+ Sbjct: 992 CSDT 995 >At1g30640.1 68414.m03747 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 562 Score = 42.7 bits (96), Expect = 1e-04 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 7/80 (8%) Frame = +2 Query: 29 GEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRMPPT--DSPA 202 G E+K H +F+ + W+ + E AP++PQ+ H DT NF ++F +P T S Sbjct: 410 GTKGVHEIKAHPWFRGVEWERLY--ESNAPYIPQVKHELDTQNF-EKFDEVPSTCQTSSK 466 Query: 203 QAP-----KHSDKLFMGYSY 247 +P D F+GY++ Sbjct: 467 SSPWRKMISSKDANFLGYTF 486 >At2g36350.1 68415.m04461 protein kinase, putative similar to protein kinase KIPK (KCBP-interacting protein kinase) [Arabidopsis thaliana] gi|7716430|gb|AAF68383 Length = 949 Score = 42.3 bits (95), Expect = 1e-04 Identities = 22/44 (50%), Positives = 29/44 (65%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQL 133 KDP RLG +G A E+KRH FF+ LNW A+ R +P P +P + Sbjct: 877 KDPESRLGSEKG-AAEIKRHPFFEGLNW-ALIRCAIP-PELPDI 917 >At5g40030.1 68418.m04854 protein kinase, putative similar to stpk1 protein kinase [Solanum tuberosum] gi|1200256|emb|CAA62476 Length = 499 Score = 41.9 bits (94), Expect = 2e-04 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQ 130 KDP++RLG +G A E+K+H FF N+NW A+ R P P +P+ Sbjct: 422 KDPKKRLGFKKG-ATEIKQHPFFNNVNW-ALIRSTTP-PEIPK 461 >At2g44830.1 68415.m05582 protein kinase, putative similar to protein kinase PVPK-1 [Phaseolus vulgaris] SWISS-PROT:P15792 Length = 765 Score = 41.5 bits (93), Expect = 3e-04 Identities = 32/92 (34%), Positives = 42/92 (45%), Gaps = 10/92 (10%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHA--------ADTCN 157 KDP+ RLG G A E+K+H FF+ +NW A+ R P P VP+ D Sbjct: 676 KDPKNRLGTKRG-ATEIKQHPFFEGVNW-ALIRCSTP-PEVPRQMETEPPPKYGPIDPVG 732 Query: 158 FADEFTRM--PPTDSPAQAPKHSDKLFMGYSY 247 F RM PP S A A S F+ + + Sbjct: 733 FGSNSKRMMGPPAVSAAAADTKSGGKFLDFEF 764 >At2g26700.1 68415.m03203 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 525 Score = 41.5 bits (93), Expect = 3e-04 Identities = 18/43 (41%), Positives = 29/43 (67%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQ 130 K+P++RLG +G E +KRH FF+ +NW + R + P+VP+ Sbjct: 444 KNPKKRLGSLKGSIE-IKRHEFFEGVNWALI--RSIKPPWVPK 483 >At3g45780.1 68416.m04953 protein kinase / nonphototropic hypocotyl protein 1 (NPH1) / phototropin identical to SP|O48963 Nonphototropic hypocotyl protein 1 (EC 2.7.1.37) (Phototropin) {Arabidopsis thaliana}, cDNA nonphototropic hypocotyl 1 (NPH1) GI:2832240; contains Pfam profiles PF00069:Protein kinase domain and PF00785:PAC motif Length = 996 Score = 41.1 bits (92), Expect = 3e-04 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAAD 148 +DP++RLG EG A E+K+HSFF+ +NW + P P S A+ Sbjct: 931 RDPKKRLGCFEG-ANEVKQHSFFKGINWALIRCTNPPELETPIFSGEAE 978 >At1g53700.1 68414.m06110 protein kinase, putative similar to cucumber protein kinase CsPK3 [Cucumis sativus] gi|7416109|dbj|BAA93704 Length = 476 Score = 40.7 bits (91), Expect = 4e-04 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVP 112 KDPR+RLG G A+++KRH FF+ + W + + P Sbjct: 379 KDPRKRLGCARG-AQDIKRHEFFEGIKWPLIRNYKPP 414 >At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) / protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 Length = 1168 Score = 40.3 bits (90), Expect = 6e-04 Identities = 23/65 (35%), Positives = 38/65 (58%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRM 181 ++P +RLG A E+K+H FF+++NWD +AR++ A FVP + DT F + Sbjct: 1023 ENPVQRLGAT--GAGEVKQHHFFKDINWDTLARQK--AMFVPS-AEPQDTSYFMSRYIWN 1077 Query: 182 PPTDS 196 P ++ Sbjct: 1078 PEDEN 1082 >At5g03640.1 68418.m00323 protein kinase family protein contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 926 Score = 40.3 bits (90), Expect = 6e-04 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 K+P RLG +G A E+KRH+FF+ LNW A+ R +P P +P Sbjct: 857 KEPENRLGTEKG-AAEIKRHAFFEGLNW-ALIRCAIP-PELP 895 >At3g14370.1 68416.m01818 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 480 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVP 112 KDPR+RLG G A+++KRH FF + W + + P Sbjct: 375 KDPRKRLGCARG-AQDIKRHPFFDGIKWPLIRHYKPP 410 >At1g03920.1 68414.m00377 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 569 Score = 39.5 bits (88), Expect = 0.001 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 6/79 (7%) Frame = +2 Query: 29 GEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNF-----ADEFTRMPPTD 193 G A ++K H +F+ + W+ + + E A F+P+++ DT NF D T+ P Sbjct: 422 GSTGASQIKAHPWFEGVQWEKIYQME--AAFIPEVNDDLDTQNFEKFDEEDNQTQAPSRT 479 Query: 194 SPAQAPKHS-DKLFMGYSY 247 P + S D F+GY+Y Sbjct: 480 GPWRKMLSSKDINFVGYTY 498 >At3g52890.2 68416.m05829 protein kinase (KIPK) identical to protein kinase KIPK (KCBP-interacting protein kinase) [Arabidopsis thaliana] gi|7716430|gb|AAF68383 Length = 934 Score = 39.1 bits (87), Expect = 0.001 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 K+P RLG +G E +KRH FF+ LNW A+ R +P P +P Sbjct: 858 KEPENRLGSEKGSVE-IKRHPFFEGLNW-ALIRCAIP-PELP 896 >At3g52890.1 68416.m05828 protein kinase (KIPK) identical to protein kinase KIPK (KCBP-interacting protein kinase) [Arabidopsis thaliana] gi|7716430|gb|AAF68383 Length = 934 Score = 39.1 bits (87), Expect = 0.001 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 K+P RLG +G E +KRH FF+ LNW A+ R +P P +P Sbjct: 858 KEPENRLGSEKGSVE-IKRHPFFEGLNW-ALIRCAIP-PELP 896 >At5g58140.3 68418.m07277 protein kinase family protein / non phototropic hypocotyl 1-like protein (NPL1) contains Pfam domains, PF00069: Protein kinase domain and PF00785: PAC motif; similar to SP:O48963 Nonphototropic hypocotyl protein 1 (Phototropin) [Mouse-ear cress] {Arabidopsis thaliana}; identical to cDNA non phototropic hypocotyl 1-like (NPL1) GI:5391441 Length = 915 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLS 136 +DP RLG +G A E+K+H+FF+ +NW + R P P LS Sbjct: 843 RDPSSRLGS-KGGANEIKQHAFFRGINWPLI-RGMSPPPLDAPLS 885 >At5g58140.2 68418.m07276 protein kinase family protein / non phototropic hypocotyl 1-like protein (NPL1) contains Pfam domains, PF00069: Protein kinase domain and PF00785: PAC motif; similar to SP:O48963 Nonphototropic hypocotyl protein 1 (Phototropin) [Mouse-ear cress] {Arabidopsis thaliana}; identical to cDNA non phototropic hypocotyl 1-like (NPL1) GI:5391441 Length = 915 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLS 136 +DP RLG +G A E+K+H+FF+ +NW + R P P LS Sbjct: 843 RDPSSRLGS-KGGANEIKQHAFFRGINWPLI-RGMSPPPLDAPLS 885 >At5g58140.1 68418.m07275 protein kinase family protein / non phototropic hypocotyl 1-like protein (NPL1) contains Pfam domains, PF00069: Protein kinase domain and PF00785: PAC motif; similar to SP:O48963 Nonphototropic hypocotyl protein 1 (Phototropin) [Mouse-ear cress] {Arabidopsis thaliana}; identical to cDNA non phototropic hypocotyl 1-like (NPL1) GI:5391441 Length = 915 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLS 136 +DP RLG +G A E+K+H+FF+ +NW + R P P LS Sbjct: 843 RDPSSRLGS-KGGANEIKQHAFFRGINWPLI-RGMSPPPLDAPLS 885 >At3g44610.1 68416.m04796 protein kinase family protein similar to viroid symptom modulation protein (protein kinase)[Lycopersicon esculentum] gi|7672777|gb|AAF66637; contains protein kinase domain, Pfam:PF00069 Length = 451 Score = 38.7 bits (86), Expect = 0.002 Identities = 22/42 (52%), Positives = 26/42 (61%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP RRLG G A +KRH FFQ +NW A+ P PF+P Sbjct: 392 KDPSRRLGSSLG-ATAVKRHPFFQGVNW-ALLMCTRP-PFLP 430 >At2g20040.1 68415.m02342 protein kinase, putative similar to protein kinase [Homo sapiens] gi|1052737|emb|CAA59733 Length = 261 Score = 38.3 bits (85), Expect = 0.002 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 26 GGEGDAEELKRHSFFQNLNWDAVARRE--VPAPFVPQLSHAADTCN 157 G +G E +K+H +F L W+A++ RE VP + ++ H + N Sbjct: 191 GSQGGPESIKKHPWFNGLKWEAISNREFQVPQEIISRIHHHLENDN 236 >At3g23310.1 68416.m02940 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 568 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 6/79 (7%) Frame = +2 Query: 29 GEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFAD-EFTRMPPTDSPAQ 205 G A E+K H +F + W+ + ++ A F+PQ++ DT NF E T +P Sbjct: 408 GTKGANEIKEHPWFSGVEWEKL--YQMKAAFIPQVNDELDTQNFEKFEETDKQVPKTPKS 465 Query: 206 AP-----KHSDKLFMGYSY 247 P D F+GY+Y Sbjct: 466 GPWRKMLSSKDINFVGYTY 484 >At3g12690.3 68416.m01586 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 37.9 bits (84), Expect = 0.003 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP RR+ G A E+K+H FF+ +NW A+ R P P +P Sbjct: 488 KDPHRRIAYTRG-ATEIKQHPFFEGVNW-ALVRSAAP-PHIP 526 >At3g12690.2 68416.m01585 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 37.9 bits (84), Expect = 0.003 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP RR+ G A E+K+H FF+ +NW A+ R P P +P Sbjct: 488 KDPHRRIAYTRG-ATEIKQHPFFEGVNW-ALVRSAAP-PHIP 526 >At3g12690.1 68416.m01584 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 37.9 bits (84), Expect = 0.003 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP RR+ G A E+K+H FF+ +NW A+ R P P +P Sbjct: 488 KDPHRRIAYTRG-ATEIKQHPFFEGVNW-ALVRSAAP-PHIP 526 >At2g19400.1 68415.m02263 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 527 Score = 37.9 bits (84), Expect = 0.003 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +2 Query: 5 DPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNF 160 D RLG AE++K H++F+++ W+ + E+ A F P ++ DT NF Sbjct: 393 DSEHRLGSHGAGAEQIKAHTWFKDVEWEKL--YEMDAAFKPVVNGELDTQNF 442 >At1g16440.1 68414.m01966 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 431 Score = 37.5 bits (83), Expect = 0.004 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAAD-TCNFADEFTR 178 K+P+ R+ G A E+K+H FF+ +NW A+ R E P P L D +C E Sbjct: 347 KEPQNRIAYKRG-ATEIKQHPFFEGVNW-ALIRGETP----PHLPEPVDFSCYVKKEKES 400 Query: 179 MPP 187 +PP Sbjct: 401 LPP 403 >At1g51170.1 68414.m05754 protein kinase family protein Length = 404 Score = 36.7 bits (81), Expect = 0.007 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP +R G G A E+K H+FF+ + W+ + P PF+P Sbjct: 319 KDPTKRFGFWRG-AAEIKEHAFFKGVRWELLTEVLRP-PFIP 358 >At5g47750.1 68418.m05899 protein kinase, putative similar to protein kinase G11A [Oryza sativa] SWISS-PROT:P47997 Length = 586 Score = 36.3 bits (80), Expect = 0.010 Identities = 19/43 (44%), Positives = 29/43 (67%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQ 130 K+P++RLG G A E+K+H FF+ +NW A+ R P P +P+ Sbjct: 506 KEPQQRLGFKRG-ATEVKQHPFFEGVNW-ALIRCATP-PEIPK 545 >At3g27580.1 68416.m03446 protein kinase, putative similar to serine/threonine protein kinase [Arabidopsis thaliana] gi|217861|dbj|BAA01715 Length = 578 Score = 36.3 bits (80), Expect = 0.010 Identities = 20/43 (46%), Positives = 28/43 (65%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQ 130 K+P+ RL G A E+K+H FFQ++NW A+ R P P +PQ Sbjct: 495 KEPQHRLAYRRG-ATEIKQHPFFQSVNW-ALIRCTSP-PQIPQ 534 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 36.3 bits (80), Expect = 0.010 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP RRLG G A E+K +FF + WD + P PF+P Sbjct: 320 KDPNRRLGCHRG-AAEIKELAFFAGVRWDLLTEVLRP-PFIP 359 >At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 486 Score = 36.3 bits (80), Expect = 0.010 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 5 DPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 DP RR G G + LKRH FF+ ++W + R + P P Sbjct: 291 DPSRRPGAGSEGYDSLKRHPFFKGVDWKNL-RSQTPPKLAP 330 >At1g79250.1 68414.m09239 protein kinase, putative similar to viroid symptom modulation protein/dual-specificity protein kinase [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 555 Score = 36.3 bits (80), Expect = 0.010 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQ 130 K+P++R+ G A E+K+H FF+ +NW A+ R P P VP+ Sbjct: 459 KEPQKRIAYKRG-ATEIKQHPFFEGVNW-ALIRSATP-PHVPE 498 >At4g13000.1 68417.m02029 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 372 Score = 34.7 bits (76), Expect = 0.029 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP RR+ + E +K H FF+ L+WD V + P P++P Sbjct: 305 KDPSRRI-----NVEGIKGHDFFKGLDWDLVLKVSRP-PYIP 340 >At5g55910.1 68418.m06972 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 498 Score = 33.5 bits (73), Expect = 0.067 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAV---ARREVPAP 118 K+P+ RL G A E+K+H FF+ +NW V + E+P P Sbjct: 425 KEPQHRLAYKRG-ATEIKQHPFFEGVNWALVRCASPPEIPKP 465 >At4g26610.1 68417.m03835 protein kinase, putative similar to protein kinase G11A [Oryza sativa] SWISS-PROT:P47997 Length = 506 Score = 33.5 bits (73), Expect = 0.067 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAV---ARREVPAP 118 K+P+ RL G A E+K+H FF+ +NW V + E+P P Sbjct: 435 KEPQHRLAYKRG-ATEMKQHPFFEGVNWALVRCASPPEIPKP 475 >At3g25250.1 68416.m03154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 421 Score = 33.5 bits (73), Expect = 0.067 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAAD 148 KDP RR+ + EE+K H FF+ ++W+ V P P++P D Sbjct: 312 KDPSRRI-----NVEEIKGHDFFRGVDWEKVILVSRP-PYIPAPDDGGD 354 >At2g34650.1 68415.m04256 protein kinase PINOID (PID) identical to protein kinase PINOID [Arabidopsis thaliana] gi|7208442|gb|AAF40202; contains protein kinase domain, Pfam:PF00069 Length = 438 Score = 33.5 bits (73), Expect = 0.067 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +2 Query: 2 KDPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 KDP +RLG G A E+K H FF+ LN+ + R + P +P Sbjct: 373 KDPTKRLGSRRG-AAEVKVHPFFKGLNFALI--RTLTPPEIP 411 >At5g04510.2 68418.m00450 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 408 Score = 32.3 bits (70), Expect = 0.16 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +2 Query: 5 DPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 +P RR G G LKRH FF ++W + R + P P Sbjct: 290 EPSRRPGAGSEGYVALKRHPFFNGVDWKNL-RSQTPPKLAP 329 >At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 491 Score = 32.3 bits (70), Expect = 0.16 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +2 Query: 5 DPRRRLGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 +P RR G G LKRH FF ++W + R + P P Sbjct: 290 EPSRRPGAGSEGYVALKRHPFFNGVDWKNL-RSQTPPKLAP 329 >At5g09890.1 68418.m01143 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 515 Score = 31.1 bits (67), Expect = 0.36 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = +2 Query: 29 GEGDAEELKRHSFFQNLNWDAVARREVPAPFVPQLSHAADTCNFADEFTRMPPTDSPAQA 208 G EE+K H +F+ WD + ++ A + P + DT NF ++F + SP++A Sbjct: 391 GTRGVEEIKSHPWFKGTPWDKL--YDMEAAYRPIVDGELDTQNF-EKFPEV--EGSPSEA 445 Query: 209 PK 214 P+ Sbjct: 446 PQ 447 >At3g10160.1 68416.m01218 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS3) nearly identical to gi:17976757 Length = 464 Score = 29.1 bits (62), Expect = 1.5 Identities = 19/74 (25%), Positives = 30/74 (40%) Frame = +2 Query: 92 VARREVPAPFVPQLSHAADTCNFADEFTRMPPTDSPAQAPKHSDKLFMGYSYVAPSILVS 271 + + ++PA VPQLS A D +P PK D + +G S + Sbjct: 119 IFKPQIPAFTVPQLSEAMDVLQKTANNLEVPLEVVAPLEPKKLDGVTLGLSGDHQLVNAG 178 Query: 272 ENIISDQIWMQATG 313 + + W+Q TG Sbjct: 179 LAVSLSRCWLQRTG 192 >At2g18915.2 68415.m02208 F-box family protein / LOV kelch protein 2 (LKP2) / adagio 2 (ADO2) E3 ubiquitin ligase SCF complex F-box subunit; identical to Adagio 2 GI:13487070 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif and PF00646: F-box domain; identical to cDNA LOV kelch protein 2 GI:18146957; identical to cDNA Adagio 2 (ADO2) GI:13487069 Length = 611 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 20 LGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 + GG D+ L +F +L+ D A RE+P P+ P Sbjct: 413 VSGGCADSGALLSDTFLLDLSMDIPAWREIPVPWTP 448 >At2g18915.1 68415.m02207 F-box family protein / LOV kelch protein 2 (LKP2) / adagio 2 (ADO2) E3 ubiquitin ligase SCF complex F-box subunit; identical to Adagio 2 GI:13487070 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif and PF00646: F-box domain; identical to cDNA LOV kelch protein 2 GI:18146957; identical to cDNA Adagio 2 (ADO2) GI:13487069 Length = 601 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 20 LGGGEGDAEELKRHSFFQNLNWDAVARREVPAPFVP 127 + GG D+ L +F +L+ D A RE+P P+ P Sbjct: 403 VSGGCADSGALLSDTFLLDLSMDIPAWREIPVPWTP 438 >At2g40830.3 68415.m05041 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 328 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 111 QRRSCPNCRTRLTRATSRMSSRGCLPPIRQPRLPNTATS 227 Q SCP CR L A+ SS+ P R R ++++S Sbjct: 223 QHNSCPVCRQELPSASGPSSSQNRTTPTRNYRSSSSSSS 261 >At2g40830.2 68415.m05040 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 328 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 111 QRRSCPNCRTRLTRATSRMSSRGCLPPIRQPRLPNTATS 227 Q SCP CR L A+ SS+ P R R ++++S Sbjct: 223 QHNSCPVCRQELPSASGPSSSQNRTTPTRNYRSSSSSSS 261 >At2g40830.1 68415.m05039 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 328 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 111 QRRSCPNCRTRLTRATSRMSSRGCLPPIRQPRLPNTATS 227 Q SCP CR L A+ SS+ P R R ++++S Sbjct: 223 QHNSCPVCRQELPSASGPSSSQNRTTPTRNYRSSSSSSS 261 >At3g61570.1 68416.m06896 intracellular protein transport protein USO1-related contains weak similarity to intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 712 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 198 GESVGGIRVNSSAKLHVSAACDN 130 G VGGI SA+LH +AA DN Sbjct: 625 GRFVGGILGGKSAELHANAASDN 647 >At2g12190.1 68415.m01316 cytochrome P450, putative Length = 512 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 175 RELIREVARVSRVRQLGHERRWYL 104 R L E+ SRVR H RRW L Sbjct: 133 RNLTSEILHPSRVRSYSHARRWVL 156 >At1g64950.1 68414.m07362 cytochrome P450, putative similar to cytochrome P450 89A2 (CYPLXXXIX) (SP:Q42602) [Arabidopsis thaliana];similar to cytochrome P450 (GI:438242) [Solanum melongena] Length = 510 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 175 RELIREVARVSRVRQLGHERRWYL 104 R L E+ SRVR H RRW L Sbjct: 133 RNLTSEILHPSRVRSYSHARRWVL 156 >At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); WDVCF variant 1 (gi:12006981) [Mus musculus] Length = 386 Score = 27.9 bits (59), Expect = 3.4 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +2 Query: 146 DTCN--FADEFTRMPPTDSPAQAPKHSDKLFMGYSYVAPSILVSENIISDQIWMQATGQK 319 DTCN AD+ R Q H++ G ++VA +V E +IW TG K Sbjct: 142 DTCNVQIADDSERSEEDSGLLQDKDHAE----GTTFVA---VVGEQPTEVEIWDLNTGDK 194 Query: 320 TEKLKGWTPKDSP 358 +L +P +SP Sbjct: 195 IIQLPQSSPDESP 207 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -3 Query: 170 THPRSCTCQPRATIGARTALVPHVSPQHPNSNSGKRSASSVLRRHPR 30 ++ RS T RAT+ A A +P+ ++SG +++ R +PR Sbjct: 182 SNSRSSTPTSRATLTAARATTSTAAPRTTTTSSGSARSATPTRSNPR 228 >At1g64940.1 68414.m07361 cytochrome P450, putative similar to cytochrome p450 GI:438242 from [Solanum melongena] Length = 511 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 175 RELIREVARVSRVRQLGHERRWYL 104 R L E+ SR+R H RRW L Sbjct: 134 RNLTSEILHPSRLRSYSHARRWVL 157 >At1g33770.1 68414.m04174 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 614 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 323 EKLKGWTPKDSPFFQKYAVDLSVPLLGDGSYSVCRKCIHRQSG 451 E +KGW P+ + F+K + +G G+YS+ K ++G Sbjct: 128 EAIKGWVPRRADSFEK------LDKIGQGTYSIVYKARDLETG 164 >At5g43935.1 68418.m05375 flavonol synthase, putative similar to flavonol synthase from Arabidopsis thaliana [SP|Q96330], Matthiola incana [SP|O04395]; contains Pfam profile PF03171 2OG-Fe(II) oxygenase superfamily Length = 293 Score = 26.6 bits (56), Expect = 7.7 Identities = 13/51 (25%), Positives = 21/51 (41%) Frame = +2 Query: 146 DTCNFADEFTRMPPTDSPAQAPKHSDKLFMGYSYVAPSILVSENIISDQIW 298 D + PP+DS AP H+D F G + + + + + D W Sbjct: 155 DKAQYVMRINYYPPSDSAIGAPAHTD--FCGLALLVSNEVPGLQVFKDDHW 203 >At4g04695.1 68417.m00689 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 484 Score = 26.6 bits (56), Expect = 7.7 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +2 Query: 299 MQATGQKTEKLKGWTPKDSPFFQKYAVDLSVPLLGDGSYSVCRKCIHRQSG 451 M K K T + PF V + LG G + + RKC+ + SG Sbjct: 1 MGCYSSKNLKQSKRTILEKPFVDIGKVYILGDELGQGQFGITRKCVEKTSG 51 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,132,483 Number of Sequences: 28952 Number of extensions: 251350 Number of successful extensions: 981 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -