BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0986 (685 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q55CU7 Cluster: Origin recognition complex subunit 2; n... 33 6.5 UniRef50_Q55BP7 Cluster: Putative uncharacterized protein; n=1; ... 33 8.6 UniRef50_Q54HY9 Cluster: Putative uncharacterized protein; n=1; ... 33 8.6 >UniRef50_Q55CU7 Cluster: Origin recognition complex subunit 2; n=1; Dictyostelium discoideum AX4|Rep: Origin recognition complex subunit 2 - Dictyostelium discoideum AX4 Length = 391 Score = 33.1 bits (72), Expect = 6.5 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +3 Query: 102 TKLTPKH----RKVIFSNNKINENNQNGATNEIFILRKLYRKFK 221 +K+ PKH +K+ S K EN +NGA N F K+Y K Sbjct: 50 SKIQPKHEKEKKKLFESYYKTRENEENGADNHCFKFNKIYTDLK 93 >UniRef50_Q55BP7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 881 Score = 32.7 bits (71), Expect = 8.6 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 90 SNFTTKLTPKHRKVIFSN--NKINENNQNGATNEIFILRKL 206 SN T +L K ++F N NKI E N N + N I I K+ Sbjct: 187 SNTTNELFQKRHNLVFGNLGNKITEQNNNNSNNNININNKI 227 >UniRef50_Q54HY9 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 446 Score = 32.7 bits (71), Expect = 8.6 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +3 Query: 84 IISNFTTKLTPKHRKV--IFSNNKINENNQNGATNEIFILRKLYRKFKRYGV*YN 242 I NF + L ++ + I SNN N NN N N I ILR Y K YN Sbjct: 131 IYKNFNSNLIENYKIISTILSNNDNNNNNINNNNNNIQILRDNYNSQKIISNYYN 185 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,627,851 Number of Sequences: 1657284 Number of extensions: 11225153 Number of successful extensions: 43236 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42126 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -