BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-0972
(761 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q6ILG4 Cluster: HDC09483; n=1; Drosophila melanogaster|... 34 4.4
>UniRef50_Q6ILG4 Cluster: HDC09483; n=1; Drosophila
melanogaster|Rep: HDC09483 - Drosophila melanogaster
(Fruit fly)
Length = 229
Score = 33.9 bits (74), Expect = 4.4
Identities = 14/42 (33%), Positives = 28/42 (66%), Gaps = 1/42 (2%)
Frame = +2
Query: 137 TVGP-PASVPPTHFYMYKEWDIHDKTALRLRPHVSSSTSRCD 259
TV P P++ PP++ Y++ E ++H K + PH+S++ +R +
Sbjct: 80 TVPPTPSATPPSYPYLHLEENLHHKLSSHRFPHISTTPARLE 121
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 707,773,301
Number of Sequences: 1657284
Number of extensions: 13762506
Number of successful extensions: 25845
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25844
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63381147830
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -