BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0972 (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) 28 7.2 >SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 32.7 bits (71), Expect = 0.33 Identities = 22/80 (27%), Positives = 35/80 (43%) Frame = +2 Query: 143 GPPASVPPTHFYMYKEWDIHDKTALRLRPHVSSSTSRCDVHLFRLCIR*ADIARTKPSRL 322 GP VPP F + E I D L+P S+ S D L+R + + A + Sbjct: 489 GPTGLVPPVIFDLIDEQRIFDSA---LKPKGSTGPSGMDAELYRRILCSKNFATEGKTLR 545 Query: 323 AESAVISNHQRSMSFSPDLL 382 E A+++ + ++ P LL Sbjct: 546 EEIAILTRNLLKFNYQPSLL 565 >SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) Length = 1019 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 517 KKKSGHPNQETIRRISR*GNKKEK 588 K SGH +Q+TI RIS N+ EK Sbjct: 475 KTNSGHKDQDTIIRISNSHNRNEK 498 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,149,178 Number of Sequences: 59808 Number of extensions: 434169 Number of successful extensions: 847 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -