BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0972 (761 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 31 4.5 AK131091-1|BAC85141.1| 381|Homo sapiens FLJ00304 protein protein. 31 4.5 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 31 4.5 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 143 GPPASVPPTHFYMYKEWDIHDKTALRLRPHVSSSTSRCDVHLFRLCIR 286 GPP+SVP + K H + ALR VS + DVH+ +C+R Sbjct: 191 GPPSSVPKSRHLTIKLTPAHSRKALRNSRIVS---QKDDVHVCIMCLR 235 >AK131091-1|BAC85141.1| 381|Homo sapiens FLJ00304 protein protein. Length = 381 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 143 GPPASVPPTHFYMYKEWDIHDKTALRLRPHVSSSTSRCDVHLFRLCIR 286 GPP+SVP + K H + ALR VS + DVH+ +C+R Sbjct: 113 GPPSSVPKSRHLTIKLTPAHSRKALRNSRIVS---QKDDVHVCIMCLR 157 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 143 GPPASVPPTHFYMYKEWDIHDKTALRLRPHVSSSTSRCDVHLFRLCIR 286 GPP+SVP + K H + ALR VS + DVH+ +C+R Sbjct: 82 GPPSSVPKSRHLTIKLTPAHSRKALRNSRIVS---QKDDVHVCIMCLR 126 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,038,571 Number of Sequences: 237096 Number of extensions: 2181304 Number of successful extensions: 3217 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3217 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -