BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0970 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein... 29 3.9 At5g41080.2 68418.m04994 glycerophosphoryl diester phosphodieste... 28 6.8 At5g41080.1 68418.m04993 glycerophosphoryl diester phosphodieste... 28 6.8 >At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein contains Pfam profile: PF01068 ATP dependent DNA ligase domain Length = 1417 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 685 KVKADSK-LHTYIHTYNLTYCDKLQFTKYIINF 590 KVK +S Y+HT + +CD+++F ++ F Sbjct: 157 KVKLESSGFEKYVHTGDFRFCDEMRFDPFLNGF 189 >At5g41080.2 68418.m04994 glycerophosphoryl diester phosphodiesterase family protein weak similarity to SP|P37965 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) {Bacillus subtilis}; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 358 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 2/28 (7%) Frame = -3 Query: 469 VGFNF-LRYKFQTFYEKYYLVHI-KSIL 392 +GFN L++ QT YE+ +LVHI +S+L Sbjct: 155 LGFNIELKFDDQTVYEREFLVHILRSVL 182 >At5g41080.1 68418.m04993 glycerophosphoryl diester phosphodiesterase family protein weak similarity to SP|P37965 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) {Bacillus subtilis}; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 374 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 2/28 (7%) Frame = -3 Query: 469 VGFNF-LRYKFQTFYEKYYLVHI-KSIL 392 +GFN L++ QT YE+ +LVHI +S+L Sbjct: 171 LGFNIELKFDDQTVYEREFLVHILRSVL 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,680,332 Number of Sequences: 28952 Number of extensions: 232338 Number of successful extensions: 385 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -