SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0969
         (786 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...   124   2e-30
EF519439-2|ABP73488.1|  152|Anopheles gambiae CTL4 protein.            26   1.5  
L10440-1|AAA29360.1|  154|Anopheles gambiae transposase protein.       24   6.1  
AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    24   6.1  
EF519478-2|ABP73566.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519477-2|ABP73564.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519476-2|ABP73562.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519475-2|ABP73560.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519474-2|ABP73558.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519473-2|ABP73556.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519472-2|ABP73554.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519471-2|ABP73552.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519470-2|ABP73550.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519469-2|ABP73548.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519468-2|ABP73546.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519467-2|ABP73544.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519466-2|ABP73542.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519465-2|ABP73540.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519464-2|ABP73538.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519463-2|ABP73536.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519462-2|ABP73534.1|  163|Anopheles gambiae CTL4 protein.            23   8.1  
EF519461-2|ABP73532.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519460-2|ABP73530.1|  166|Anopheles gambiae CTL4 protein.            23   8.1  
EF519459-2|ABP73528.1|  166|Anopheles gambiae CTL4 protein.            23   8.1  
EF519458-2|ABP73526.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519457-2|ABP73524.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519456-2|ABP73522.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519455-2|ABP73520.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519454-2|ABP73518.1|  161|Anopheles gambiae CTL4 protein.            23   8.1  
EF519453-2|ABP73516.1|  176|Anopheles gambiae CTL4 protein.            23   8.1  
EF519452-2|ABP73514.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519451-2|ABP73512.1|  171|Anopheles gambiae CTL4 protein.            23   8.1  
EF519450-2|ABP73510.1|  171|Anopheles gambiae CTL4 protein.            23   8.1  
EF519449-2|ABP73508.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519448-2|ABP73506.1|  171|Anopheles gambiae CTL4 protein.            23   8.1  
EF519447-2|ABP73504.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519446-2|ABP73502.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519445-2|ABP73500.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519444-2|ABP73498.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519443-2|ABP73496.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519442-2|ABP73494.1|  177|Anopheles gambiae CTL4 protein.            23   8.1  
EF519441-2|ABP73492.1|  164|Anopheles gambiae CTL4 protein.            23   8.1  
EF519440-2|ABP73490.1|  165|Anopheles gambiae CTL4 protein.            23   8.1  
EF519438-2|ABP73486.1|  161|Anopheles gambiae CTL4 protein.            23   8.1  
EF519437-2|ABP73484.1|  165|Anopheles gambiae CTL4 protein.            23   8.1  
AF513634-1|AAM53606.1|  216|Anopheles gambiae glutathione S-tran...    23   8.1  

>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
            polyprotein protein.
          Length = 1726

 Score =  124 bits (300), Expect = 2e-30
 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 1/134 (0%)
 Frame = -1

Query: 777  LSTDPSEFDVLTPGHFWLVVQLVSAPSYDIADVSINYLTRWQCIKQSTLHFWRRWKLEYL 598
            +S DP++ + LTPGHF +   L +    DIADV  N L  W+ I++   H W RW  EYL
Sbjct: 1590 ISEDPNDMEALTPGHFLVGNHLQTVADVDIADVPTNRLNHWRLIQKHMQHIWNRWHREYL 1649

Query: 597  HTLQQRQKWYVDALNLSINDLVLIHNDNAPCQQWSLGRVEQIHPGLDGRVRVVTVRTQNS 418
             TLQ+R KW  +A+++    LV++  DN    +W + RV  +HPG DG  RVVT++  N 
Sbjct: 1650 STLQKRAKWNKNAISIEPGRLVILQEDNVAVSKWPMARVVDLHPGKDGVTRVVTLKCANG 1709

Query: 417  K-LKRLVTKLSPLP 379
            K ++R + +++PLP
Sbjct: 1710 KEIRRPIHRIAPLP 1723


>EF519439-2|ABP73488.1|  152|Anopheles gambiae CTL4 protein.
          Length = 152

 Score = 25.8 bits (54), Expect = 1.5
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 174 FSQTLLFNLCVCPC 133
           F++ +  NLCVCPC
Sbjct: 5   FTEMITQNLCVCPC 18


>L10440-1|AAA29360.1|  154|Anopheles gambiae transposase protein.
          Length = 154

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 534 VLIHNDNAPCQQ 499
           VL H DNAPC +
Sbjct: 123 VLFHQDNAPCHK 134


>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling
            promoter protein.
          Length = 1197

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +3

Query: 711  PIGRPTKNVPVSGRRI 758
            P+G PT   P  GRR+
Sbjct: 1022 PVGTPTDGAPSEGRRL 1037


>EF519478-2|ABP73566.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519477-2|ABP73564.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519476-2|ABP73562.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519475-2|ABP73560.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519474-2|ABP73558.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519473-2|ABP73556.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519472-2|ABP73554.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519471-2|ABP73552.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519470-2|ABP73550.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519469-2|ABP73548.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519468-2|ABP73546.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519467-2|ABP73544.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519466-2|ABP73542.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519465-2|ABP73540.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519464-2|ABP73538.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519463-2|ABP73536.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519462-2|ABP73534.1|  163|Anopheles gambiae CTL4 protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 23  NLCVCPC 29


>EF519461-2|ABP73532.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519460-2|ABP73530.1|  166|Anopheles gambiae CTL4 protein.
          Length = 166

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 26  NLCVCPC 32


>EF519459-2|ABP73528.1|  166|Anopheles gambiae CTL4 protein.
          Length = 166

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 26  NLCVCPC 32


>EF519458-2|ABP73526.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519457-2|ABP73524.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519456-2|ABP73522.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519455-2|ABP73520.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519454-2|ABP73518.1|  161|Anopheles gambiae CTL4 protein.
          Length = 161

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 21  NLCVCPC 27


>EF519453-2|ABP73516.1|  176|Anopheles gambiae CTL4 protein.
          Length = 176

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 36  NLCVCPC 42


>EF519452-2|ABP73514.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519451-2|ABP73512.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 31  NLCVCPC 37


>EF519450-2|ABP73510.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 31  NLCVCPC 37


>EF519449-2|ABP73508.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519448-2|ABP73506.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 31  NLCVCPC 37


>EF519447-2|ABP73504.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519446-2|ABP73502.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519445-2|ABP73500.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519444-2|ABP73498.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519443-2|ABP73496.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519442-2|ABP73494.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 37  NLCVCPC 43


>EF519441-2|ABP73492.1|  164|Anopheles gambiae CTL4 protein.
          Length = 164

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 24  NLCVCPC 30


>EF519440-2|ABP73490.1|  165|Anopheles gambiae CTL4 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 25  NLCVCPC 31


>EF519438-2|ABP73486.1|  161|Anopheles gambiae CTL4 protein.
          Length = 161

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 21  NLCVCPC 27


>EF519437-2|ABP73484.1|  165|Anopheles gambiae CTL4 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 153 NLCVCPC 133
           NLCVCPC
Sbjct: 25  NLCVCPC 31


>AF513634-1|AAM53606.1|  216|Anopheles gambiae glutathione
           S-transferase D5 protein.
          Length = 216

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +3

Query: 561 HQRTTFDVAAMYANILISND 620
           +QR  FD+  +Y NIL + D
Sbjct: 94  NQRLFFDIGTLYKNILANVD 113


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 870,162
Number of Sequences: 2352
Number of extensions: 18520
Number of successful extensions: 70
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 67
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 70
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 82328994
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -