BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0969 (786 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 124 2e-30 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 26 1.5 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 24 6.1 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 6.1 EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. 23 8.1 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 23 8.1 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 23 8.1 EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 23 8.1 EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. 23 8.1 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 23 8.1 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 23 8.1 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. 23 8.1 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 23 8.1 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 23 8.1 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 23 8.1 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 23 8.1 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 23 8.1 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 23 8.1 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 124 bits (300), Expect = 2e-30 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 1/134 (0%) Frame = -1 Query: 777 LSTDPSEFDVLTPGHFWLVVQLVSAPSYDIADVSINYLTRWQCIKQSTLHFWRRWKLEYL 598 +S DP++ + LTPGHF + L + DIADV N L W+ I++ H W RW EYL Sbjct: 1590 ISEDPNDMEALTPGHFLVGNHLQTVADVDIADVPTNRLNHWRLIQKHMQHIWNRWHREYL 1649 Query: 597 HTLQQRQKWYVDALNLSINDLVLIHNDNAPCQQWSLGRVEQIHPGLDGRVRVVTVRTQNS 418 TLQ+R KW +A+++ LV++ DN +W + RV +HPG DG RVVT++ N Sbjct: 1650 STLQKRAKWNKNAISIEPGRLVILQEDNVAVSKWPMARVVDLHPGKDGVTRVVTLKCANG 1709 Query: 417 K-LKRLVTKLSPLP 379 K ++R + +++PLP Sbjct: 1710 KEIRRPIHRIAPLP 1723 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 25.8 bits (54), Expect = 1.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 174 FSQTLLFNLCVCPC 133 F++ + NLCVCPC Sbjct: 5 FTEMITQNLCVCPC 18 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.8 bits (49), Expect = 6.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 534 VLIHNDNAPCQQ 499 VL H DNAPC + Sbjct: 123 VLFHQDNAPCHK 134 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.8 bits (49), Expect = 6.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 711 PIGRPTKNVPVSGRRI 758 P+G PT P GRR+ Sbjct: 1022 PVGTPTDGAPSEGRRL 1037 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. Length = 163 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 23 NLCVCPC 29 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 26 NLCVCPC 32 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 26 NLCVCPC 32 >EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 21 NLCVCPC 27 >EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. Length = 176 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 36 NLCVCPC 42 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 31 NLCVCPC 37 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 31 NLCVCPC 37 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 31 NLCVCPC 37 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 37 NLCVCPC 43 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 24 NLCVCPC 30 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 25 NLCVCPC 31 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 21 NLCVCPC 27 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 153 NLCVCPC 133 NLCVCPC Sbjct: 25 NLCVCPC 31 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 23.4 bits (48), Expect = 8.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 561 HQRTTFDVAAMYANILISND 620 +QR FD+ +Y NIL + D Sbjct: 94 NQRLFFDIGTLYKNILANVD 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 870,162 Number of Sequences: 2352 Number of extensions: 18520 Number of successful extensions: 70 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -