BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0969 (786 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 4.3 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 9.8 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 693 HNLELKPIGRPTKNVPVSGRRIH 761 ++L +K PT N P+ G IH Sbjct: 1380 NSLTMKVRPHPTDNAPIHGYTIH 1402 Score = 21.4 bits (43), Expect = 9.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 362 IIVDFGGGNVREPTKIPLS*STPSIGIMKNCN 267 I++ GGG + TKI S T G+ K N Sbjct: 1120 IVIPSGGGIYTKDTKITSSSETILHGLKKYTN 1151 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -1 Query: 783 CILSTDPSEFDVLTPGHFWLVVQLVSAPSYD 691 C+ S D V +W ++ SAP+ D Sbjct: 322 CMRSVDAKTISVQQWNSYWGILGFPSAPTID 352 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -1 Query: 783 CILSTDPSEFDVLTPGHFWLVVQLVSAPSYD 691 C+ S D V +W ++ SAP+ D Sbjct: 322 CMRSVDAKTISVQQWNSYWGILGFPSAPTID 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,287 Number of Sequences: 438 Number of extensions: 5140 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -