BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0961 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 1.8 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 1.8 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 1.8 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.3 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 21 9.4 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 9.4 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 9.4 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 315 GTSEASKKQKLFLMLWCPDTAKVKKKMLYFSL 410 G S + +W PDT V +K YF + Sbjct: 79 GVETLSVGSEFIKNIWVPDTFFVNEKQSYFHI 110 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 315 GTSEASKKQKLFLMLWCPDTAKVKKKMLYFSL 410 G S + +W PDT V +K YF + Sbjct: 79 GVETLSVGSEFIKNIWVPDTFFVNEKQSYFHI 110 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 315 GTSEASKKQKLFLMLWCPDTAKVKKKMLYFSL 410 G S + +W PDT V +K YF + Sbjct: 18 GVETLSVGSEFIKNIWVPDTFFVNEKQSYFHI 49 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 319 VPWHWCVYSKSNRPYLH 269 +P HW VY + N P LH Sbjct: 33 IPEHWLVYPEPN-PSLH 48 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.0 bits (42), Expect = 9.4 Identities = 13/46 (28%), Positives = 17/46 (36%) Frame = +2 Query: 431 PCRSSEVHSSDRPFGSVL*GRPREASGHRSPINRIYTRARDETEPG 568 P R + + +P RP R P R+ A E EPG Sbjct: 25 PTRPTRLRREAKPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPG 70 Score = 21.0 bits (42), Expect = 9.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 491 RPREASGHRSPINRIYTRARDETEPG 568 RP S R P R+ A E EPG Sbjct: 101 RPVYISQPRPPHPRLRREAEPEAEPG 126 Score = 21.0 bits (42), Expect = 9.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 491 RPREASGHRSPINRIYTRARDETEPG 568 RP S R P R+ A E EPG Sbjct: 157 RPVYISQPRPPHPRLRREAEPEAEPG 182 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 571 KTGFGFVASSCVN 533 +TGFG + S CV+ Sbjct: 45 QTGFGMLESGCVS 57 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 256 PFCRSSRNCSYSALR 212 P+CR + +C YS R Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,223 Number of Sequences: 438 Number of extensions: 3340 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -