BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0957 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 29 0.39 SPAC458.06 |||phosphoinositide binding protein|Schizosaccharomyc... 25 6.4 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 29.1 bits (62), Expect = 0.39 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 303 YHHPAHFDREAVMSFGLKGGAAVVE-TLEVISQVG 404 + P+ F E V+ L GG AVV+ TLE I Q G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDVTLEAIKQSG 121 >SPAC458.06 |||phosphoinositide binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 364 Score = 25.0 bits (52), Expect = 6.4 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +2 Query: 140 RLQMYKQSSILLHW 181 R+Q+Y+ + +LLHW Sbjct: 300 RIQLYQSNPVLLHW 313 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,123,200 Number of Sequences: 5004 Number of extensions: 41371 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -