BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0957 (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 pr... 25 1.1 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 7.7 >AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 368 GCSTLQTETHYCFTVEMSRVVIP-TRADSHEVLPPVKF*MPVPNFPFALC 222 G Q + HY ++ +++ + AD + + P+ + VP+ P LC Sbjct: 36 GQKIAQLQMHYLLSMILTKFELTLAEADQQDAIKPILKMITVPSAPVKLC 85 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.6 bits (46), Expect = 7.7 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 120 ELCNYNVGYRCINNRLFCCIGILEYT-SYNVDNS 218 ELCN+N Y C + C +G + T N+ NS Sbjct: 479 ELCNFNGDYVC--GQCQCYVGWIGKTCECNLQNS 510 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,148 Number of Sequences: 2352 Number of extensions: 10649 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -