BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0957 (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.5 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 21 7.2 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 21 7.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.5 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +3 Query: 243 WHWHLEFYWW*DLM*IRTGRYHHPAHFDREAVMS 344 WHWHL + + D+ + R ++ + +M+ Sbjct: 210 WHWHLVYPFEGDIRIVNKDRRGELFYYMHQQIMA 243 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.5 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -3 Query: 101 THTSIDPKEHVYIEI 57 +H++ DP+ H+Y E+ Sbjct: 1678 SHSTWDPRRHMYEEL 1692 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 82 GSIDVCVTDNKFTNC 126 G D C NK+T+C Sbjct: 121 GETDECNIGNKYTDC 135 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 82 GSIDVCVTDNKFTNC 126 G D C NK+T+C Sbjct: 121 GETDECNIGNKYTDC 135 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 161 SSILLHWHLG 190 SSILLHW G Sbjct: 1418 SSILLHWKSG 1427 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 161 SSILLHWHLG 190 SSILLHW G Sbjct: 1414 SSILLHWKSG 1423 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 134 PPDMYRLRPPPNPRF 148 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 382 PPDMYRLRPPPNPRF 396 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 367 PPDMYRLRPPPNPRF 381 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 434 PIDIYNANTPPNLRY 390 P D+Y PPN R+ Sbjct: 383 PPDMYRLRPPPNPRF 397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,858 Number of Sequences: 438 Number of extensions: 3388 Number of successful extensions: 22 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -