BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0955 (703 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|S... 29 0.85 SPBC25H2.06c |hrf1||COPII-coated vesicle component Hrf1 |Schizos... 25 7.9 >SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 638 Score = 28.7 bits (61), Expect = 0.85 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 562 YKLNHAHTTRYERISEFNFSKRNSFLKAVCFWN 660 YKLN Y IS+ FSK N FL F N Sbjct: 289 YKLNQVGEKEYSTISDLCFSKGNLFLYTGAFDN 321 >SPBC25H2.06c |hrf1||COPII-coated vesicle component Hrf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 25.4 bits (53), Expect = 7.9 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +2 Query: 173 LTLSK*YACVCASNTNTSNNMYLLCIIKKKY*HSSLLLYIPYK-CGKFHTPPSAQFS*KW 349 L SK A V T YLL I + LL + YK G T S F W Sbjct: 171 LRASKACAVVLVEFLATRLGCYLLNISSQSQ-VLDLLAFSGYKFVGLILTSLSKLFEMPW 229 Query: 350 IQSFCFTYIIIYRSSFRLR 406 + F F Y+ + + F LR Sbjct: 230 VTRFVFLYMYLATAFFLLR 248 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,599,702 Number of Sequences: 5004 Number of extensions: 49439 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -