BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0955 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 25 1.7 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 25 3.0 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 544 VQRDLMYKLNHAHTTRYERISEFNFSKRNSFLKAVCF 654 ++R L + + HTTR + + EF + N KAV F Sbjct: 1 MERILRGVMRYRHTTREQMVQEFRKVRDNPQPKAVFF 37 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 361 KTLYPFLRKLRGRRCMKFPTLVGNIEK 281 K L P+L +L MK PT+V N+EK Sbjct: 134 KGLAPYLAELEK---MKIPTVVANLEK 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,459 Number of Sequences: 2352 Number of extensions: 11852 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -