BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0954 (383 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 33 1.4 UniRef50_Q2SB14 Cluster: ATPase with chaperone activity, ATP-bin... 31 9.9 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 33.5 bits (73), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 342 RGGARYPIRPIVSR 383 RGGARYPIRPIVSR Sbjct: 260 RGGARYPIRPIVSR 273 >UniRef50_Q2SB14 Cluster: ATPase with chaperone activity, ATP-binding subunit; n=1; Hahella chejuensis KCTC 2396|Rep: ATPase with chaperone activity, ATP-binding subunit - Hahella chejuensis (strain KCTC 2396) Length = 1093 Score = 30.7 bits (66), Expect = 9.9 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = -3 Query: 240 LEKTLWHC--PDCFFNFVDLRFTSAGRLTHWLFA---FQIRTH 127 +E LW C PD F + LRF S L LFA +Q+R H Sbjct: 61 VEHLLWLCFQPDYRFELIHLRFKSGMHLVDGLFAVAQYQVREH 103 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 310,020,526 Number of Sequences: 1657284 Number of extensions: 4193221 Number of successful extensions: 8584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8582 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 15293670012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -