BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0954 (383 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 24 9.4 SPCC191.08 |||DUF1715 family protein|Schizosaccharomyces pombe|c... 24 9.4 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 23.8 bits (49), Expect = 9.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 136 YLECKEPVS*TTGAGETQVNKVEETIRAVP*SFLQDK 246 YLE KE + G+T ++ +E + +V SFL D+ Sbjct: 1525 YLELKESLPGVLQNGQTDLDPSKEQMSSVIVSFLLDE 1561 >SPCC191.08 |||DUF1715 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 134 Score = 23.8 bits (49), Expect = 9.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 239 WRKLYGTARIVSSTLLTCVSPA 174 W K+ A++VSS L T + PA Sbjct: 103 WNKITAKAKVVSSLLGTKILPA 124 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,279,477 Number of Sequences: 5004 Number of extensions: 18068 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 126307516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -