BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0954 (383 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0333 - 12541946-12542029,12544231-12544278,12545053-125451... 30 0.72 09_04_0519 - 18276797-18276874,18277214-18277419,18277527-182776... 27 6.7 >05_03_0333 - 12541946-12542029,12544231-12544278,12545053-12545158, 12546943-12547046,12547127-12547264,12547395-12547799 Length = 294 Score = 29.9 bits (64), Expect = 0.72 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 135 RTHSCFEQKKILQKKKNNTP-LHFTALAQNKFE 40 R H CF+ K L+ N P LH+ L KFE Sbjct: 98 RVHLCFKSSKSLKCNLNQVPVLHYLCLDDQKFE 130 >09_04_0519 - 18276797-18276874,18277214-18277419,18277527-18277683, 18278069-18278454,18279291-18279317,18279609-18279720 Length = 321 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 1 LTERDCSTEKYKKFKFILCQCCEVK 75 + ERDCS E K + + C C +K Sbjct: 6 MKERDCSDESKKAGEMLACSCKMIK 30 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,170,906 Number of Sequences: 37544 Number of extensions: 109529 Number of successful extensions: 171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 636799876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -