BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0954 (383 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_4423| Best HMM Match : 7tm_1 (HMM E-Value=5.5e-08) 27 6.9 >SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 135 RTHSCFEQKKILQKKKNNTPLHFTALAQNKFEFFIFFR 22 +T S ++++I QK++ PL+ L Q F FF+ Sbjct: 307 KTLSTQQRERIFQKQQTQNPLYLKTLLQELLSFGEFFQ 344 >SB_4423| Best HMM Match : 7tm_1 (HMM E-Value=5.5e-08) Length = 1167 Score = 26.6 bits (56), Expect = 6.9 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -3 Query: 183 FTSAGRLTHWLFAFQI---RTHSCFEQKKILQKKKNNTPLHFTALAQNK 46 FT+ G H++F+F + R CF K IL N +HF ++ N+ Sbjct: 386 FTTQGMSQHYIFSFSVICSRKLPCFLWKIILFTDSN---MHFRNISDNR 431 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,522,024 Number of Sequences: 59808 Number of extensions: 129383 Number of successful extensions: 281 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -