BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0952 (310 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 22 1.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 1.5 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 20 5.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 20 5.9 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 22.2 bits (45), Expect = 1.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 246 PRVPPFCRSSRNCSYSALR 190 P+ P+CR + +C YS R Sbjct: 5 PQECPYCRRNFSCYYSLKR 23 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 1.5 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = -3 Query: 293 WHWWVYSKSKQAISAFPGYRPSA 225 W W + + + FP RP A Sbjct: 862 WRHWKFPNLVEVLDEFPSVRPFA 884 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 20.2 bits (40), Expect = 5.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +2 Query: 86 ACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGER 193 +C K+K RY Y EK ++ T +R Sbjct: 3 SCSKDRNREYKEKDRRYEKLYNEKEKLLEERTSRKR 38 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 20.2 bits (40), Expect = 5.9 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -2 Query: 258 HICIPRVPPFCRSSRNCSYSALRSP 184 ++C+ V FC ++ Y R+P Sbjct: 131 NLCMISVDRFCAITKPLKYGVKRTP 155 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,462 Number of Sequences: 438 Number of extensions: 1372 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6471036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -