BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0944 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 23 3.8 AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. 22 6.7 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 22.6 bits (46), Expect = 3.8 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -3 Query: 544 PLCRNHCVCYSSFPLK*H-ELKLEQS-TPEVCKM*QEERRANCSWIDEKKL 398 P CR + CY + LK H + K EQS T VC+ R S K L Sbjct: 9 PYCRRNFSCY--YSLKRHFQDKHEQSDTLYVCEFCNRRYRTKNSLTTHKSL 57 >AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. Length = 57 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +3 Query: 252 YLHNTLRADRADRIDCITSRRNSSDQEEVCTRSGHNL 362 + N RADR R+ C + C + H+L Sbjct: 6 HFENEERADRHRRVTCDLLSFKGQVNDSACAANCHSL 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,164 Number of Sequences: 438 Number of extensions: 3092 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -