BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0942 (738 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1851.03 |ckb1||CK2 family regulatory subunit |Schizosaccharo... 29 0.91 SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharo... 25 8.5 SPAC23H3.03c |||nitrogen permease regulator family|Schizosacchar... 25 8.5 >SPAC1851.03 |ckb1||CK2 family regulatory subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 231 Score = 28.7 bits (61), Expect = 0.91 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +1 Query: 64 RKLYRIPH---LVIIQGCYVV*GCY*KRKGAGDELTPKEKCSGQ*ALGEGLCDIEHRKSS 234 R LY + H ++ QG Y + Y K+ G P+ C+GQ L GL DI H KS Sbjct: 81 RHLYGLIHARYILTAQGLYKMLEKY-KKCDFGH--CPRVLCNGQPMLPVGLSDIAHTKSV 137 Query: 235 SPSCVR 252 C R Sbjct: 138 KLYCPR 143 >SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.4 bits (53), Expect = 8.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 212 SHSPSPSAHCPLHFSLGVNSSPAP 141 S +P+P + PLHF+ NSSP P Sbjct: 213 SFNPTPFSSSPLHFT---NSSPNP 233 >SPAC23H3.03c |||nitrogen permease regulator family|Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 25.4 bits (53), Expect = 8.5 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 7/55 (12%) Frame = +3 Query: 591 LINF--LRAVIFKIFNFPYNFRST--HNF---HKVFSSYI*IRHHFDELTRLVKR 734 LI+F ++ +I+++ +PY R T +N K + +HHFDEL +K+ Sbjct: 335 LISFGTIKGLIYRVHKYPYLERRTMRNNLTEEEKKLLGLLDGKHHFDELCVTLKK 389 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,165,086 Number of Sequences: 5004 Number of extensions: 69678 Number of successful extensions: 151 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -