BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0942 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 0.98 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 2.3 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 2.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 3.0 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 24.6 bits (51), Expect = 0.98 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 498 PRMCKMVTKNQISDRTHLVLVIVKLEYTTQQPYCYKACG 382 P C + +K I LVI +T ++PY KACG Sbjct: 175 PHKCTVCSKTFIQSGQ---LVIHMRTHTGEKPYVCKACG 210 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 530 AKRVTNLSCALNFHLFLKTAP 592 AK+ L + FHL++ TAP Sbjct: 351 AKKGFKLKQGIQFHLYINTAP 371 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 209 HSPSPSAHCPLHFSLGVNSSPA 144 +SPSP+ P H ++SPA Sbjct: 60 NSPSPTGSSPQHSGSSASTSPA 81 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 542 LLAWHYWGHDTFQLRLE 492 +L W W +D +QL LE Sbjct: 146 VLKWASWTYDGYQLELE 162 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,546 Number of Sequences: 438 Number of extensions: 4412 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -