BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0939 (796 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0014 + 84379-84600,84737-84830,84935-85086,85212-85299,853... 28 7.4 02_05_1133 + 34346894-34347121,34347222-34347283,34347373-343474... 28 9.8 >01_01_0014 + 84379-84600,84737-84830,84935-85086,85212-85299, 85348-86681,87291-87398,87500-87583 Length = 693 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = -3 Query: 137 SFKFSLDVIPENSYHLPN--H*VVLATLVLATNENKNIHQKKKPR 9 S+K L + EN YH+ N H V+L+T T++ H+ K PR Sbjct: 174 SYKRMLPFVTENGYHIANLSHHVLLSTFSEITSQEG--HRTKIPR 216 >02_05_1133 + 34346894-34347121,34347222-34347283,34347373-34347460, 34348005-34348268,34348346-34348586,34348672-34348748, 34348837-34349007,34349084-34349176,34349257-34349406, 34349491-34349577,34349656-34349820,34349900-34350019, 34350244-34350446,34350547-34350696,34350779-34350926, 34351046-34351129,34351207-34351308 Length = 810 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 150 FYNFYKSKIRSNYFRREFNRYVFWFEILKREIPSLAP 260 F N YK R ++ + WF+ILK +I + P Sbjct: 367 FQNLYKKYEREGKAKKVVSAQALWFDILKAQIETGTP 403 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,706,887 Number of Sequences: 37544 Number of extensions: 367527 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -