BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0939 (796 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 26 1.2 AY341213-1|AAR13777.1| 260|Anopheles gambiae SRPN9 protein. 25 3.6 AY341212-1|AAR13776.1| 260|Anopheles gambiae SRPN9 protein. 25 3.6 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 24 4.7 AY341214-1|AAR13778.1| 260|Anopheles gambiae SRPN9 protein. 24 4.7 AY341211-1|AAR13775.1| 260|Anopheles gambiae SRPN9 protein. 24 4.7 AY341210-1|AAR13774.1| 260|Anopheles gambiae SRPN9 protein. 24 4.7 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = +2 Query: 446 YVSKLIFVLILFSQMKFVFFLMKISDTRK 532 ++ ++IF+++LF+ M F+ F+ I+ T K Sbjct: 569 FLPQIIFLVLLFAYMVFMMFMKWIAYTAK 597 >AY341213-1|AAR13777.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 24.6 bits (51), Expect = 3.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 558 TFTLHTEEKLICHLLVIMWLTNKRKKNSRGGP 653 TF+ EKL CH+L + + N+ GP Sbjct: 126 TFSHAANEKLGCHILELPYSAGPSADNADDGP 157 >AY341212-1|AAR13776.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 24.6 bits (51), Expect = 3.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 558 TFTLHTEEKLICHLLVIMWLTNKRKKNSRGGP 653 TF+ EKL CH+L + + N+ GP Sbjct: 126 TFSHAANEKLGCHILELPYSAGPSADNADDGP 157 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 558 TFTLHTEEKLICHLLVIMWLTNKRKKNSRGGP 653 TF+ EKL CH+L + + N+ GP Sbjct: 252 TFSHAANEKLGCHILELPYSAGPGADNADDGP 283 >AY341214-1|AAR13778.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 558 TFTLHTEEKLICHLLVIMWLTNKRKKNSRGGP 653 TF+ EKL CH+L + + N+ GP Sbjct: 126 TFSHAANEKLGCHILELPYSAGPGADNADDGP 157 >AY341211-1|AAR13775.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 558 TFTLHTEEKLICHLLVIMWLTNKRKKNSRGGP 653 TF+ EKL CH+L + + N+ GP Sbjct: 126 TFSHAANEKLGCHILELPYSAGPGADNADDGP 157 >AY341210-1|AAR13774.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 558 TFTLHTEEKLICHLLVIMWLTNKRKKNSRGGP 653 TF+ EKL CH+L + + N+ GP Sbjct: 126 TFSHAANEKLGCHILELPYSAGPGADNADDGP 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,684 Number of Sequences: 2352 Number of extensions: 16233 Number of successful extensions: 68 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -