BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0938 (575 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 26 0.26 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 5.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.5 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.8 bits (54), Expect = 0.26 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +3 Query: 198 GGRCKCNGHASRCIPMKEG---EGSSAGGVVQLACDCKHNTAGRDCE 329 G C+ +G+ P + G S GG + CDC T G +CE Sbjct: 370 GKNCEFSGYDCDSNPCQNGGVCRISDGGGYI---CDCPSGTNGTNCE 413 Score = 23.0 bits (47), Expect = 1.9 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 6/46 (13%) Frame = +3 Query: 210 KCNGHASRCIPMKEGEGSSAGGV--VQLA----CDCKHNTAGRDCE 329 +C G + C+ S+AG + VQL C+CK GR CE Sbjct: 294 RCEGDINECL---SNPCSNAGTLDCVQLVNDYHCNCKLGFMGRHCE 336 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/24 (29%), Positives = 11/24 (45%) Frame = +3 Query: 258 GSSAGGVVQLACDCKHNTAGRDCE 329 G+ G+ C CK G +C+ Sbjct: 36 GTCIDGINSYICTCKPGFTGSNCQ 59 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 343 STSIDPGAARPPETPT 390 ST+ P ARPP TP+ Sbjct: 405 STTPRPEWARPPSTPS 420 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +1 Query: 283 NWPATASTTPP 315 NWP +T PP Sbjct: 1078 NWPTQGTTIPP 1088 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 289 PATASTTPPVEIARDASRSTSIDPGAARPPE 381 P T STT ++ T+I P A PE Sbjct: 1065 PTTTSTTTRPTTTNWPTQGTTIPPPAVVMPE 1095 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,512 Number of Sequences: 336 Number of extensions: 2971 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -