BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0937 (559 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 27 1.4 SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizos... 26 4.3 SPAC23A1.04c |mnl1||alpha mannosidase-like protein|Schizosacchar... 26 4.3 SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr... 25 7.5 SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schiz... 25 10.0 SPBC1198.13c |tfg2|SPBC660.03c|transcription factor TFIIF comple... 25 10.0 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 27.5 bits (58), Expect = 1.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 10 GAICLVNSGNERDSSLLNRRRYLGVRGLVSRNSLTT 117 G + ++N G E D L N RYL V L N++TT Sbjct: 56 GEVFVLNDGGEVDLDLGNYERYLNVT-LTHDNNITT 90 >SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 25.8 bits (54), Expect = 4.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 525 YGNLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 397 YG +T+S SS+V P P P + + N+S+ S Sbjct: 321 YGIDSNLYTNSNSSSIVQNPLQPARTGPAAINYNYTTNYSVSS 363 >SPAC23A1.04c |mnl1||alpha mannosidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 787 Score = 25.8 bits (54), Expect = 4.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 550 LMILPQVPLRKPCYDFYFL*MIKFGQLP 467 L++ ++ L K + +YF +KFGQLP Sbjct: 337 LVLAGELELAKKMHLYYFSIYLKFGQLP 364 >SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 593 Score = 25.0 bits (52), Expect = 7.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -2 Query: 336 LLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENM 235 L G+P ++G++ P EG++ G EN+ Sbjct: 292 LYGVPSMYGVVTLPYSVREGINIFLDGHIPTENL 325 >SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 24.6 bits (51), Expect = 10.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 16 ICLVNSGNERDSSLLNRRRYL 78 +CL N +D LLNR RY+ Sbjct: 227 LCLWNHAYYKDYGLLNRSRYI 247 >SPBC1198.13c |tfg2|SPBC660.03c|transcription factor TFIIF complex beta subunit Tfg2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 307 Score = 24.6 bits (51), Expect = 10.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 262 PGPLGQGEHADSFSVARVRPRTSKGI 185 PG LG + + + V+PRT +G+ Sbjct: 161 PGTLGSRSRSTTSFIRNVKPRTGEGL 186 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,194,913 Number of Sequences: 5004 Number of extensions: 42917 Number of successful extensions: 84 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -