BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0937 (559 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 25 1.7 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 1.7 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 25 1.7 AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. 23 6.8 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 6.8 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 9.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 9.0 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 25.0 bits (52), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 286 ARRSFSGLPGPLGQGEHADSFSVARV 209 A RS S L PLG HA +V RV Sbjct: 91 AGRSTSSLTVPLGTSRHASGGTVVRV 116 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 313 GDNCKPQSPARRSFSGLPGPLG 248 G C P+ A + GLPGP+G Sbjct: 91 GGCCLPKCFAEKGNRGLPGPMG 112 Score = 23.4 bits (48), Expect = 5.1 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -1 Query: 376 KGRDVINASL*LALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQ 245 KG +V A+ T GD +P P R G G GQ Sbjct: 287 KGEEVYGATGTTTTTGPKGEKGDRGEPGEPGRSGEKGQAGDRGQ 330 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 483 SLVNFPTTPTAVKPPRVGPKTS 418 SLVN T T PP V P TS Sbjct: 397 SLVNGGTPSTTTMPPSVAPTTS 418 >AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. Length = 144 Score = 23.0 bits (47), Expect = 6.8 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 16 ICLVNSGNERDSSLLNRRRYLG 81 ICL+ + + D+S LN++ + G Sbjct: 44 ICLIQNESRYDTSALNKKNWNG 65 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.0 bits (47), Expect = 6.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 291 DWGLQLSPINEEFLVSASHK 350 D GL+++P EF++ +SH+ Sbjct: 670 DNGLKIAPTKTEFIMVSSHQ 689 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 288 GDWGLQLSPINEEFLV 335 G G+QLSP+NE ++ Sbjct: 58 GYGGVQLSPVNENIVI 73 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 9.0 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = -1 Query: 325 SSFMGDNCKPQSPARRSFSGLP---GPLGQGEHADSFSVARVRPRTSKG 188 +S G N +P P R G+P GP G A R P+ KG Sbjct: 310 ASEKGQNGEPGVPGLRGNDGIPGLEGPSGPKGDAGVPGYGRPGPQGEKG 358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,739 Number of Sequences: 2352 Number of extensions: 11554 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -