BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0932 (712 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42620.1 68418.m05188 expressed protein 29 2.3 At3g21660.1 68416.m02731 UBX domain-containing protein contains ... 28 5.3 At3g44300.1 68416.m04757 nitrilase 2 (NIT2) identical to SP|P329... 28 7.0 >At5g42620.1 68418.m05188 expressed protein Length = 841 Score = 29.5 bits (63), Expect = 2.3 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = +3 Query: 114 SCEWDNKHHRVSCNCLPGFTGHLC--DSCESSNAVFPLCHDIPTEPPCKCD--VRGIVDP 281 SC ++ C CL G+ GH C SC ++ C T+ C C+ GI Sbjct: 606 SCNFNGDCVDGKCRCLLGYHGHDCRNRSCPNNCNGHGKC---TTQGVCICENGFTGIDCS 662 Query: 282 TRECDEVC 305 T CDE C Sbjct: 663 TAICDEQC 670 >At3g21660.1 68416.m02731 UBX domain-containing protein contains Pfam profile: PF00789 UBX domain Length = 435 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 544 NPKVLLPLSSYSQIGYGSNYAPPRRPLRP 630 N ++ +P SS+S S Y+P R LRP Sbjct: 42 NLRIKIPTSSFSTFDGSSGYSPSRLQLRP 70 >At3g44300.1 68416.m04757 nitrilase 2 (NIT2) identical to SP|P32962 Nitrilase 2 (EC 3.5.5.1) {Arabidopsis thaliana} Length = 339 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 115 PANGTTSITEYRATVFLASPVTSATPAS 198 P NG S T RAT+ AS V + TPA+ Sbjct: 8 PFNGVASSTIVRATIVQASTVYNDTPAT 35 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,246,890 Number of Sequences: 28952 Number of extensions: 309641 Number of successful extensions: 776 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -