BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0931 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0255 - 15422536-15422640,15422734-15422790,15422917-154230... 31 1.3 05_01_0066 - 465526-466107,466541-466741 28 9.0 >11_04_0255 - 15422536-15422640,15422734-15422790,15422917-15423013, 15423155-15423222,15423299-15423344,15423467-15423621, 15423767-15423995,15424124-15424200,15425804-15425856, 15426082-15426139 Length = 314 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 262 GITCAFPVECAHL*QSNEYCLFGVYLTGL 348 G++C F C HL + + FGVY+TG+ Sbjct: 57 GLSCLFWYSCIHLQTCSLWMSFGVYVTGI 85 >05_01_0066 - 465526-466107,466541-466741 Length = 260 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 459 LWISLFSKPQPMPTAKYGKVL-DDILDSNCLFIYLLNLKSC 340 L + + S P YG V+ DILD NC+ I+ N +C Sbjct: 21 LSVKILSSDVGYPINLYGTVIVRDILDFNCITIFPRNRDNC 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,634,923 Number of Sequences: 37544 Number of extensions: 254231 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -