BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0931 (741 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35880.1 68417.m05095 aspartyl protease family protein contai... 28 7.5 At5g55060.1 68418.m06862 expressed protein 27 9.9 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +2 Query: 407 PYLAVGIGCGFENSDIHKLS*TLSTAFPNPNHI---VDILTF 523 P +A GI +S++HK + T+S + +PN I VD+ +F Sbjct: 472 PAMAAGIKTHNNSSELHKTNQTISKSNSSPNQISKTVDVWSF 513 >At5g55060.1 68418.m06862 expressed protein Length = 645 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = -1 Query: 462 NLWISLFSKPQPMPTAKYGKVLDDILDSNCLFIYLLNLKSC*IYSK*AVFVALLKM 295 NLW L+ +P+P K + D+ L + YL ++ + ++ + +F +L+ + Sbjct: 453 NLWRELWETAKPLPAVKQAPLFDEDLAVEGILNYLEDIPAAELFEQ--LFTSLVSL 506 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,760,110 Number of Sequences: 28952 Number of extensions: 234428 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -