BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0927 (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58728-2|AAB00589.2| 240|Caenorhabditis elegans Hypothetical pr... 28 7.2 AL132858-2|CAB60476.2| 821|Caenorhabditis elegans Hypothetical ... 27 9.5 >U58728-2|AAB00589.2| 240|Caenorhabditis elegans Hypothetical protein C54H2.4 protein. Length = 240 Score = 27.9 bits (59), Expect = 7.2 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 451 WWGTGPTHSCRPEFRREIAKRGPSVSGRLY-IRIPLLKRISR 329 WW G R + RREIA G VSG + R P +R+SR Sbjct: 116 WWSKGEVK--RNQERREIANGGQMVSGGNWNQRPPSRQRVSR 155 >AL132858-2|CAB60476.2| 821|Caenorhabditis elegans Hypothetical protein Y113G7A.3 protein. Length = 821 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 189 SNAPFNFVLFEHKMFSENVITNTDNTHRLLCNTNHNEP 76 +N+P + H +FSENV+ +T +L + + N P Sbjct: 652 NNSPDETAYYRHILFSENVLESTTMIQPVLFSYSFNGP 689 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,521,291 Number of Sequences: 27780 Number of extensions: 341804 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -