BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0925 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 38 0.007 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 35 0.051 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.83 At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 31 0.83 At5g29070.1 68418.m03617 expressed protein 30 1.1 At5g41100.2 68418.m04997 expressed protein 29 1.9 At5g41100.1 68418.m04996 expressed protein 29 1.9 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 29 1.9 At3g53140.1 68416.m05856 O-diphenol-O-methyl transferase, putati... 29 3.3 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 28 4.4 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 28 4.4 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 28 4.4 At1g30420.1 68414.m03718 ATP-binding cassette transport protein,... 28 4.4 At5g31873.1 68418.m03777 hypothetical protein 28 5.8 At5g28120.1 68418.m03396 hypothetical protein 28 5.8 At5g28110.1 68418.m03395 hypothetical protein 28 5.8 At3g30816.1 68416.m03949 hypothetical protein 28 5.8 At5g46830.1 68418.m05769 basic helix-loop-helix (bHLH) family pr... 27 7.7 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 27 7.7 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 27 7.7 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 27 7.7 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 27 7.7 At1g30410.1 68414.m03717 ATP-binding cassette transport protein,... 27 7.7 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 37.5 bits (83), Expect = 0.007 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +3 Query: 126 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHA-APVEH-SSYIHASPVVQH 299 VRH P +H +P +SH++P + ++P + H+ P+V A +PV+ SS +SP Sbjct: 165 VRHSSPP---VSHSSPPVSHSSPPTSRSSPAVSHSSPVVAASSPVKAVSSSTASSPRAAS 221 Query: 300 FSP 308 SP Sbjct: 222 PSP 224 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 34.7 bits (76), Expect = 0.051 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 150 QATAHYTPVLSHAAPVLTHAAPLIQHAGP--IVHAAPV--EHSSYIHASPVVQHFS--PV 311 Q+TA+Y S P + H P ++H P + H+ P +H Y P V+H+S PV Sbjct: 24 QSTANY--FYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPV 81 Query: 312 QHAP 323 H+P Sbjct: 82 YHSP 85 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 75 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 134 Query: 306 -PVQHAP 323 PV H+P Sbjct: 135 PPVYHSP 141 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 103 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 162 Query: 306 -PVQHAP 323 PV H+P Sbjct: 163 PPVYHSP 169 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 131 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 190 Query: 306 -PVQHAP 323 PV H+P Sbjct: 191 PPVYHSP 197 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 159 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 218 Query: 306 -PVQHAP 323 PV H+P Sbjct: 219 PPVYHSP 225 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 187 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 246 Query: 306 -PVQHAP 323 PV H+P Sbjct: 247 PPVYHSP 253 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 215 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 274 Query: 306 -PVQHAP 323 PV H+P Sbjct: 275 PPVYHSP 281 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 243 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 302 Query: 306 -PVQHAP 323 PV H+P Sbjct: 303 PPVYHSP 309 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 271 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 330 Query: 306 -PVQHAP 323 PV H+P Sbjct: 331 PPVYHSP 337 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 299 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 358 Query: 306 -PVQHAP 323 PV H+P Sbjct: 359 PPVYHSP 365 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 162 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 305 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 327 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 386 Query: 306 -PVQHAP 323 PV H+P Sbjct: 387 PPVYHSP 393 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%) Frame = +3 Query: 213 PLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS--PVQHAP 323 P ++H P + H+ P Y++ SP V+H+S PV H+P Sbjct: 71 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 113 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.7 bits (66), Expect = 0.83 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 346 QLPSNTPIMSKIMLPRSMSSHIPSRIPTPAI-----TSPNTKPV 462 Q P+ + S++ P S S+ PS+ PTP + +PN+KPV Sbjct: 726 QAPTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPV 769 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 30.7 bits (66), Expect = 0.83 Identities = 21/52 (40%), Positives = 25/52 (48%) Frame = -3 Query: 549 RCGGQLCIRPCGWNHQAEVESIRLSRHHHHGFRVGTCDRRCGDPRRNMRTHT 394 RCG C R C H +S S G RV TC ++CG PR + R HT Sbjct: 720 RCGMHACARTC---HPEPCDSFNESEA---GMRV-TCRQKCGAPRTDCR-HT 763 >At5g29070.1 68418.m03617 expressed protein Length = 307 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 194 STDSRSPFDST-CRSYCSRRPRGTFFVYTCFASSPTLQPCATCSSRAPR 337 +T R P D T C S RP T T SSPT +P +CS AP+ Sbjct: 93 ATLDRRPTDWTRCGSDTQPRPWATQGATTGPESSPTCRPTGSCSVAAPQ 141 >At5g41100.2 68418.m04997 expressed protein Length = 582 Score = 29.5 bits (63), Expect = 1.9 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 10/88 (11%) Frame = +3 Query: 126 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFS 305 +R PS A TPV S ++P+ T H+ + H++P+E H +S Sbjct: 346 MRQMTPSANAYILPTPVDSKSSPIFTKPVTQTNHSANLWHSSPLEPIKTAHKDAESNLYS 405 Query: 306 ----PVQHA------PVVHHAAIPIAVE 359 P +HA P +P+AV+ Sbjct: 406 RLPRPSEHAFSGPLKPSSTRLPVPVAVQ 433 >At5g41100.1 68418.m04996 expressed protein Length = 586 Score = 29.5 bits (63), Expect = 1.9 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 10/88 (11%) Frame = +3 Query: 126 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFS 305 +R PS A TPV S ++P+ T H+ + H++P+E H +S Sbjct: 346 MRQMTPSANAYILPTPVDSKSSPIFTKPVTQTNHSANLWHSSPLEPIKTAHKDAESNLYS 405 Query: 306 ----PVQHA------PVVHHAAIPIAVE 359 P +HA P +P+AV+ Sbjct: 406 RLPRPSEHAFSGPLKPSSTRLPVPVAVQ 433 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 201 THAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIP 347 T P H+ P +P Y ++SP H SP H+P H+ P Sbjct: 535 TRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 >At3g53140.1 68416.m05856 O-diphenol-O-methyl transferase, putative similar to GI:6688808 [Medicago sativa subsp. x varia], caffeic acid O-methyltransferase (homt1), Populus kitakamiensis, EMBL:PKHOMT1A Length = 359 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 177 LSHAAPVLTHAAPLIQHAGPIVHAAPVE 260 LS+AA VL H + A P+VH A VE Sbjct: 115 LSYAAYVLQHHQEALMRAWPLVHTAVVE 142 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/85 (23%), Positives = 33/85 (38%), Gaps = 1/85 (1%) Frame = +3 Query: 141 PSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAP-VEHSSYIHASPVVQHFSPVQH 317 P+ + PV S A H + + P ++ P +HSSY H S Sbjct: 61 PNPNPPQYTRPVTSPATQQQQHLSQPLVRPPPQAYSRPWQQHSSYTHFSSASSPLLSSSS 120 Query: 318 APVVHHAAIPIAVEHSDHVEDHAPA 392 AP +++PI+ + + PA Sbjct: 121 APASSSSSLPISGQQRGGMAIGVPA 145 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Frame = +3 Query: 162 HYTP--VLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSS----YIHASPVVQHFSPVQHAP 323 HY+P V P + H +P + P PV+H S Y P V+H+SP Sbjct: 108 HYSPPPVYKSPPPPVKHYSPPPVYKSP---PPPVKHYSPPPVYKSPPPPVKHYSPPPSYT 164 Query: 324 VVHH 335 +HH Sbjct: 165 TLHH 168 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Frame = +3 Query: 162 HYTP--VLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSS----YIHASPVVQHFSPVQHAP 323 HY+P V P + H +P + P PV+H S Y P V+H+SP Sbjct: 108 HYSPPPVYKSPPPPVKHYSPPPVYKSP---PPPVKHYSPPPVYKSPPPPVKHYSPPPSYT 164 Query: 324 VVHH 335 +HH Sbjct: 165 TLHH 168 >At1g30420.1 68414.m03718 ATP-binding cassette transport protein, putative contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1488 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 136 SWRTMLWEDTAWPWPSSITPPWQIAKIEQTTAILKNMLRCLTE 8 SW T L + + P + WQ+ + +QT ++K RC TE Sbjct: 241 SWMTPLMQ-LGYRKPITERDVWQLDQWDQTETLIKRFQRCWTE 282 >At5g31873.1 68418.m03777 hypothetical protein Length = 271 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 196 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 238 >At5g28120.1 68418.m03396 hypothetical protein Length = 506 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At5g28110.1 68418.m03395 hypothetical protein Length = 493 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At3g30816.1 68416.m03949 hypothetical protein Length = 342 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 231 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 273 >At5g46830.1 68418.m05769 basic helix-loop-helix (bHLH) family protein Length = 511 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +3 Query: 447 QHETRDGDVVKGEYSLLQPDGSIRKVEYTADHHNG 551 ++E + +++K E +++ D ++ +VE DHH G Sbjct: 424 KYEEKASEMMKIEVKIMESDDAMVRVESRKDHHPG 458 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 361 TPIMSKIMLPRSMSSHIPSRIPTPAITSPNTKP 459 +PI S P + S+ S +PA+TSP T P Sbjct: 23 SPISSPTKSPTTPSAPTTSPTKSPAVTSPTTAP 55 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 483 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 337 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 483 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 337 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 483 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 337 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At1g30410.1 68414.m03717 ATP-binding cassette transport protein, putative similar to MgATP-energized glutathione S-conjugate pump [Arabidopsis thaliana] GI:2909781; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1495 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 73 WQIAKIEQTTAILKNMLRCLTE 8 WQ+ K +QT ++K RC TE Sbjct: 261 WQLDKWDQTETLIKRFQRCWTE 282 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,536,064 Number of Sequences: 28952 Number of extensions: 346189 Number of successful extensions: 1324 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -