BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0923 (481 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68316-6|CAA92682.2| 357|Caenorhabditis elegans Hypothetical pr... 27 5.3 Z36238-2|CAA85274.1| 378|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z81056-1|CAB02902.1| 319|Caenorhabditis elegans Hypothetical pr... 27 9.3 AF106581-7|ABC48241.1| 362|Caenorhabditis elegans Nuclear hormo... 27 9.3 >Z68316-6|CAA92682.2| 357|Caenorhabditis elegans Hypothetical protein K08E4.5 protein. Length = 357 Score = 27.5 bits (58), Expect = 5.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 208 NYSLIYISLVHCTTPVYFVFKMTCDFWL 291 NY L +IS++H +T ++ F + W+ Sbjct: 246 NYYLFWISIIHFSTSFWYYFSVETKQWI 273 >Z36238-2|CAA85274.1| 378|Caenorhabditis elegans Hypothetical protein R74.4 protein. Length = 378 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 109 IKSAFKVKVECQCGQKYYWDRNTTDRIAQKEGKNYSLIY 225 IKSA++ + KY+ DRN D AQ+E K S+ Y Sbjct: 33 IKSAYR-----KLALKYHPDRNPNDAHAQEEFKKVSIAY 66 >Z81056-1|CAB02902.1| 319|Caenorhabditis elegans Hypothetical protein F09F3.1 protein. Length = 319 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 259 NIQVWYSVLMKCILKNNFYLPFAQF 185 N+ +W S L C L + YLP+ F Sbjct: 168 NLFIWRSELYPCALDRSEYLPYINF 192 >AF106581-7|ABC48241.1| 362|Caenorhabditis elegans Nuclear hormone receptor familyprotein 135 protein. Length = 362 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 422 FSDLNILGNAEKL*ITLNYLVKYLLV 345 + ++ LG+ EK + LN+ +KY+LV Sbjct: 169 YPEIGKLGHLEKKQVFLNFFIKYMLV 194 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,538,481 Number of Sequences: 27780 Number of extensions: 203541 Number of successful extensions: 424 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 882200194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -