BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0922 (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1514 + 34114626-34114637,34114766-34114841,34115022-34115347 30 1.7 02_04_0275 - 21469391-21470650 30 1.7 06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905,581... 29 3.8 03_02_0163 - 6056959-6058989 29 3.8 01_05_0647 + 23910318-23910694,23911732-23911867,23912067-239122... 28 5.1 06_03_1097 - 27570037-27570262,27570575-27570730,27570763-275708... 28 6.7 03_05_0576 + 25765137-25766420 28 6.7 >04_04_1514 + 34114626-34114637,34114766-34114841,34115022-34115347 Length = 137 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 12 ASLAVVAFAKEEKGTPKAVEEKKQDKR 92 ASL V AKEEK K EEKK DK+ Sbjct: 65 ASLLSVGPAKEEKKEEKKPEEKKDDKK 91 >02_04_0275 - 21469391-21470650 Length = 419 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/42 (26%), Positives = 27/42 (64%) Frame = +1 Query: 388 SRNTSPIPSRRKYPMR*KCPYLSPTPLKRKFPLPSRNTSNTQ 513 +R+T+P+ R +P R + +L + +KR+ P P + +++++ Sbjct: 183 ARSTAPMAPRVNFPQRTRTQFLPSSGVKRRMPSPPQVSASSE 224 >06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905, 5819969-5820064,5820147-5820266,5820401-5820663, 5821507-5821617 Length = 363 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 369 PSLPPQQF*CARGVHDDRGGSRLRWQL 289 P LPP+ C VH D GG+ +RW L Sbjct: 247 PPLPPE---CNAQVHTDYGGAAVRWGL 270 >03_02_0163 - 6056959-6058989 Length = 676 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +1 Query: 343 SKLLRW*RRCL-FRIQSRNTSPIPSRRKYPMR*KCPYLSPTPLKRKFPLPSRNTSNTQYT 519 S LL W R + Q +N SP P+ + ++ P P P P R+++ ++Y Sbjct: 5 SSLLSWPHRAISLSFQPKNPSPSPATARVSVQDP-----PPPPSDANPSPGRSSNTSRYV 59 Query: 520 YLSP 531 +++P Sbjct: 60 WVNP 63 >01_05_0647 + 23910318-23910694,23911732-23911867,23912067-23912277, 23912357-23912724,23913793-23914081,23914173-23914372, 23914452-23914646 Length = 591 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 367 RCLFRIQSRNTSPIPSRRKYPMR*KCPYLSPTPLKRKFPLPS 492 +CL + + P+P R +P + P PTP+ +P P+ Sbjct: 37 KCLMCVCDVDPHPLPPSRHHPPPPEEPEPEPTPVNHHYPPPT 78 >06_03_1097 - 27570037-27570262,27570575-27570730,27570763-27570881, 27572154-27572236,27574991-27575041,27575218-27575674, 27576139-27576228,27576672-27576701 Length = 403 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 108 LCHRCPFCLVSSLRLPSVCLSPPWQRQPRPTM 13 L HR P L S R + S WQ+QPR M Sbjct: 301 LVHRLPQALRFSNRFSCILSSARWQQQPRDGM 332 >03_05_0576 + 25765137-25766420 Length = 427 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 60 SVCLSPPWQRQPRPTMPP 7 +V +SPP Q +PRP +PP Sbjct: 98 AVSVSPPTQPRPRPELPP 115 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,103,552 Number of Sequences: 37544 Number of extensions: 247189 Number of successful extensions: 803 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -