BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0922 (611 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC117331-1|AAI17332.1| 346|Homo sapiens selenoprotein V protein. 33 1.0 AY324825-1|AAP85542.1| 346|Homo sapiens selenoprotein V protein. 33 1.0 D13633-1|BAA02797.2| 876|Homo sapiens KIAA0008 protein. 30 7.4 BT007344-1|AAP36008.1| 765|Homo sapiens discs, large homolog 7 ... 30 7.4 BC016276-1|AAH16276.2| 846|Homo sapiens discs, large homolog 7 ... 30 7.4 BC010658-1|AAH10658.2| 846|Homo sapiens discs, large homolog 7 ... 30 7.4 AB076695-1|BAB97376.1| 846|Homo sapiens hepatoma up-regulated p... 30 7.4 >BC117331-1|AAI17332.1| 346|Homo sapiens selenoprotein V protein. Length = 346 Score = 32.7 bits (71), Expect = 1.0 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +1 Query: 385 QSRNTSPIPSRRKYPMR*KCPYLSPTPLKRKFPLPSRNTSNTQYTYLSPTP 537 Q+R +P +R +R P +PTPL+ P+ +R T L+P+P Sbjct: 4 QARTPAPSSARTSTSVRASTPTRTPTPLRTPTPVRTRTPIRTLTPVLTPSP 54 >AY324825-1|AAP85542.1| 346|Homo sapiens selenoprotein V protein. Length = 346 Score = 32.7 bits (71), Expect = 1.0 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +1 Query: 385 QSRNTSPIPSRRKYPMR*KCPYLSPTPLKRKFPLPSRNTSNTQYTYLSPTP 537 Q+R +P +R +R P +PTPL+ P+ +R T L+P+P Sbjct: 4 QARTPAPSSARTSTSVRASTPTRTPTPLRTPTPVRTRTPIRTLTPVLTPSP 54 >D13633-1|BAA02797.2| 876|Homo sapiens KIAA0008 protein. Length = 876 Score = 29.9 bits (64), Expect = 7.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 39 KEEKGTPKAVEEKKQDKRGIYDIGSY 116 KEEK K E++++ KRGI+ +G Y Sbjct: 128 KEEKQLQKLKEQREKAKRGIFKVGRY 153 >BT007344-1|AAP36008.1| 765|Homo sapiens discs, large homolog 7 (Drosophila) protein. Length = 765 Score = 29.9 bits (64), Expect = 7.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 39 KEEKGTPKAVEEKKQDKRGIYDIGSY 116 KEEK K E++++ KRGI+ +G Y Sbjct: 17 KEEKQLQKLKEQREKAKRGIFKVGRY 42 >BC016276-1|AAH16276.2| 846|Homo sapiens discs, large homolog 7 (Drosophila) protein. Length = 846 Score = 29.9 bits (64), Expect = 7.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 39 KEEKGTPKAVEEKKQDKRGIYDIGSY 116 KEEK K E++++ KRGI+ +G Y Sbjct: 98 KEEKQLQKLKEQREKAKRGIFKVGRY 123 >BC010658-1|AAH10658.2| 846|Homo sapiens discs, large homolog 7 (Drosophila) protein. Length = 846 Score = 29.9 bits (64), Expect = 7.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 39 KEEKGTPKAVEEKKQDKRGIYDIGSY 116 KEEK K E++++ KRGI+ +G Y Sbjct: 98 KEEKQLQKLKEQREKAKRGIFKVGRY 123 >AB076695-1|BAB97376.1| 846|Homo sapiens hepatoma up-regulated protein protein. Length = 846 Score = 29.9 bits (64), Expect = 7.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 39 KEEKGTPKAVEEKKQDKRGIYDIGSY 116 KEEK K E++++ KRGI+ +G Y Sbjct: 98 KEEKQLQKLKEQREKAKRGIFKVGRY 123 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,045,304 Number of Sequences: 237096 Number of extensions: 1231829 Number of successful extensions: 3432 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3430 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -