BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0920 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49880.1 68418.m06177 mitotic checkpoint family protein simil... 28 5.2 At3g15410.1 68416.m01955 leucine-rich repeat family protein cont... 28 5.2 >At5g49880.1 68418.m06177 mitotic checkpoint family protein similar to mitotic checkpoint protein isoform MAD1a [Homo sapiens] GI:4580767; contains Pfam profile PF05557: Mitotic checkpoint protein Length = 726 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 611 NIQKSLKKMENDIKALEMDLNNSRVQQCPDD 703 ++Q S++K+EN++ + + LN+ CPDD Sbjct: 331 DLQLSMEKLENELSSWKSLLNDIPGVSCPDD 361 >At3g15410.1 68416.m01955 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; identical to leucine-rich repeat protein [Arabidopsis thaliana] gi|2760084|emb|CAA76000 Length = 584 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/56 (21%), Positives = 32/56 (57%) Frame = +2 Query: 533 SHDDFKSLPSHPAFFISYRAARVSMENIQKSLKKMENDIKALEMDLNNSRVQQCPD 700 SH+ LP+ + ++ VS +I + +++ + I +++D +++R+++ PD Sbjct: 76 SHNKLSQLPAAIGELTAMKSLDVSFNSISELPEQIGSAISLVKLDCSSNRLKELPD 131 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,737,643 Number of Sequences: 28952 Number of extensions: 297645 Number of successful extensions: 780 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -