BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0919 (447 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6GWY9 Cluster: Probable metalloprotease; n=1; Flavobac... 33 2.8 UniRef50_Q113K6 Cluster: Putative uncharacterized protein; n=1; ... 33 3.7 UniRef50_A4MHZ9 Cluster: Methyltransferase type 12; n=2; Geobact... 33 3.7 >UniRef50_A6GWY9 Cluster: Probable metalloprotease; n=1; Flavobacterium psychrophilum JIP02/86|Rep: Probable metalloprotease - Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) Length = 296 Score = 33.1 bits (72), Expect = 2.8 Identities = 24/67 (35%), Positives = 31/67 (46%) Frame = -3 Query: 211 LPGSLATSGARLPVGYRTLFRTFYKWYSGGSTFSEVFDAKTLYSDILFISYRTHKMYFYF 32 LP S +T+GA L + +F W +F V D T S ISY T K+YF Sbjct: 64 LPNSGSTTGASLMTTQNSTIASF--WGRSAPSFRFVRDLTTPSSTFNAISYSTGKIYFGE 121 Query: 31 SNFTIAY 11 + F AY Sbjct: 122 AIFKWAY 128 >UniRef50_Q113K6 Cluster: Putative uncharacterized protein; n=1; Trichodesmium erythraeum IMS101|Rep: Putative uncharacterized protein - Trichodesmium erythraeum (strain IMS101) Length = 636 Score = 32.7 bits (71), Expect = 3.7 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 226 SGSSKLYLIIVLTTSGLENVVLATPACRHKKSG 324 SG S Y+I L SG +N+VL ACR+K G Sbjct: 115 SGISVDYIIQQLQKSGADNIVLILDACRNKSDG 147 >UniRef50_A4MHZ9 Cluster: Methyltransferase type 12; n=2; Geobacter|Rep: Methyltransferase type 12 - Geobacter bemidjiensis Bem Length = 359 Score = 32.7 bits (71), Expect = 3.7 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -3 Query: 220 PLALPGSLATSGARLPVGYRTLFRTFYKWYSGGSTFSEVFDAKTLYSDILFI 65 PL +PG L + +P G R+ R F K + + SE Y+D LF+ Sbjct: 303 PLLIPGRLGEANPPIPRGERSFLRRFKKPVAATALLSEDLTRAKQYADKLFL 354 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 453,922,347 Number of Sequences: 1657284 Number of extensions: 8943085 Number of successful extensions: 24124 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24122 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 23183027945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -