BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0919 (447 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 3.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 22 8.6 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 3.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 193 SLDFPEALEGASGSSKLYLIIVLTTSGLENVVL 291 S+ P G SGSS+ +I GLE V+L Sbjct: 465 SIPKPGKRPGESGSSRPICLIDGVAKGLERVIL 497 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 8.6 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 233 EPEAPSSASGKSSDFRRPASGG-IPHVISYFLQVVLGRE 120 E E P ASGK+ + GG + IS F + + +E Sbjct: 1549 EREEPVRASGKAPESESGGGGGVVEETISSFKENIFLKE 1587 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,956 Number of Sequences: 2352 Number of extensions: 8903 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -